Description
| SKU-Pack Size | Availability | Price |
| abs04722-25μg | 1-2 weeks | $133.00 |
| abs04722-100μg | 1-2 weeks | $333.00 |
| Overview | |
| Description | SDS-PAGE  The bands on the electrophoresis were labeled as follows: Marker, 1 microgram (non-reduced), and 1 microgram (reduced). By rearranging this information, we can restate that the electrophoresis results displayed separate bands for the Marker, as well as for 1 microgram of non-reduced and reduced samples. |
| Synonym | PD-L1 is an abbreviation for Programmed Cell Death 1 Ligand 1, also known as PDCD1 Ligand 1, Programmed Death Ligand 1, B7 Homolog 1, B7-H1, CD274, B7H1, PDCD1L1, PDCD1LG1, or PDL1. |
| Source | HEK293 |
| Molecular Weight | 30-35 KD |
| Appearance | lyophilized powder |
| Properties | |
| Sequence | FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKL QDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTS TLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERHHHHHH |
| Purity | ＞95% SDS-PAGE |
| Endotoxin Level | ＜0.1 EU/μg |
| Storage Temp. | To store the sample, it is recommended to use it within 2-4 weeks at 4°C. If the sample needs to be stored for a shorter period, it can be kept in a freezer at -20℃. For long-term storage, it is recommended to store the sample at -80℃. These storage conditions are essential to maintain the quality of the sample and prevent any degradation. Proper storage can ensure that the sample remains viable and can be used for future experiments. |
| General Notes | We offer a product that includes 5% trehalose. If you have no requirement for a recombinant protein with trehalose, please reach out to us. Our team is here to assist you. |
| Target | |
| Background | PD-L1, which stands for Programmed Cell Death 1 Ligand 1, is a transmembrane protein expressed in humans. It has a size of 40kDa and is known for its role in suppressing the immune system in specific scenarios, including pregnancy, tissue transplantation, and autoimmune diseases. Furthermore, it plays a crucial role in certain diseases such as hepatitis. Researchers believe that PD-L1's function in suppressing the immune system may be utilized to create new treatments for a variety of diseases. Understanding the precise mechanisms of how PD-L1 works is essential for future therapeutic developments.Normally, the immune system responds to foreign antigens that accumulate in the lymph nodes or spleen, triggering antigen-specific cytotoxic T cells (CD8+ Tcell proliferation).The combination of programmed cell death receptor-1 (PD-1) and programmed cell death ligand 1(PD-L1) can transmit inhibitory signals and reduce the proliferation of CD8+ T cells in lymph nodes. In addition, PD-1 can also control the accumulation of antigen-specific T cells in lymph nodes by regulating Bcl-2 gene. |
| Accession | Q9NZQ7 |
Hot Tags: recombinant human pd-l1 his tag, China recombinant human pd-l1 his tag suppliers
Send Inquiry
You Might Also Like
