Recombinant Human Death Receptor 3/DR3/TNFRSF25 (C-Fc) #abs04271

abs04271-10ug

1-2 Weeks

138

abs04271-50ug

1-2 Weeks

382

abs04271-500ug

1-2 Weeks

1604

abs04271-1mg

1-2 Weeks

2328

Description

Our Mammalian expression system is responsible for producing Recombinant Human Death Receptor 3, where the target gene that encodes Gln25-Phe201 is expressed with a Fc tag positioned at the C-terminus. We ensure that our product is highly similar to the original content, and we pride ourselves on maintaining consistency and accuracy throughout the manufacturing process. Our goal is to provide a reliable source of top-quality Recombinant Human Death Receptor 3, giving researchers and biotech professionals the resources they need to conduct cutting-edge research and development.

Other names

WSL1, also known as tumor necrosis factor receptor superfamily member 25 or APO3, is a protein that belongs to the death receptor 3 family. It is also identified by other names such as DDR3, TNFRSF12, WSL, TNFRSF25, LARD, Protein WSL, Lymphocyte-associated receptor of death, Apoptosis-mediating receptor TRAMP, Apoptosis-inducing receptor AIR, Apoptosis-mediating receptor DR3, and Apo-3.
The role of WSL1 is of particular interest in the field of apoptosis, as it is involved in mediating programmed cell death. Its activation triggers signaling pathways that lead to cell death, serving as a critical player in regulating cellular processes.
WSL1, or DR3, is a receptor protein that binds to specific ligands, initiating downstream signaling cascades. By interacting with various ligands, WSL1 can modulate immune responses and regulate cell survival. This multifunctional protein is widely expressed in different tissues and cell types, suggesting its involvement in various biological processes.
Understanding the function and regulation of WSL1 is crucial for unraveling its potential roles in disease pathogenesis. Dysregulation of this receptor may contribute to the development of certain diseases, including autoimmune disorders and cancer. Hence, further research and investigation into WSL1 and its signaling pathways are warranted to uncover its therapeutic potential in various pathological conditions.
In summary, WSL1, also known as TNFRSF25, APO3, or DR3, is a protein belonging to the tumor necrosis factor receptor superfamily. Its diverse nomenclature reflects its multifaceted roles in apoptosis regulation and immune response modulation. Unraveling the mechanisms underlying WSL1 function may provide valuable insights into disease processes and therapeutic strategies.

Source

Human Cells

Format

The content has been lyophilized from a solution of PBS with a pH of 7.4, which was filtered through a 0.2 μm filter. To create similar content, one could say that the solution of PBS with a pH of 7.4 was subject to filtration through a 0.2 μm filter prior to being lyophilized.

Properties

aa_sequence

CTSQCREQSPCADTDLNNPVGCPCFCGCQGGHFVDPGAVNLTCNCSRHEQACSTWERTRVCLPEG ANHLLCCGVCCHKACSNYTEQGAFQPKTATQVWGVCDSQSTPQYQQPPLFCRCQHVAVCCSAKRTS DRMGuiGRCKTLFAPSDPLCDCHERAGQSYCEPHACREWWTFTCQTSPYCSVCGCDAQLKHCVVSRH SSLTCDRCGDGTVSEHKYSPHPVQEQCDFCVQGLAVDDEKGKKSVRPRTSAPSHKRQPQQRAEEY LRHESKMWSVYCVVNGKQPEQKNLCPETTQSDNTKAFCMCNCAPWRSH SHYLPALGNSEKQTVSDCGCYHWIDNMKVGSVCQVASEHDPEKICCPLVQPKDFTACWDWKGQSQET GAPDKIAAFSLPPRVGKSGWQDLPEENENHISKTVVQPPQSQ#######

Concentration

The purity of the protein was determined to be over 95% by analyzing it through reducing SDS-PAGE. To provide a similar content based on this information, we could say that the protein was found to have a purity level of more than 95% after undergoing analysis using reducing SDS-PAGE.

Endotoxin_level

The LAL test detected levels below 0.1 ng/μg (1 IEU/μg) in the sample.

Reconstitution

Before opening, ensure to always centrifuge tubes. Avoid mixing through vortex or pipetting and refrain from reconstituting below a concentration of 100 μg/ml. Dissolve the lyophilized protein in ddH2O and be sure to aliquot the reconstituted solution to prevent excessive freeze-thaw cycles. It is important to maintain content similarity by rearranging the aforementioned information.

Stability & Storage

It is advised to keep lyophilized protein at a temperature lower than -20°C, although it can remain stable at room temperature for up to three weeks. If the protein is reconstituted, the solution should be stored at a temperature of 4-7°C for 2-7 days. For long-term storage, it is best to aliquot and place the reconstituted samples at a temperature lower than -20°C for up to 3 months.

Target

Background

Tumor necrosis factor receptor superfamily member 25 (TNFRSF25) contains 1 death domain and 4 TNFR-Cys repeats. TNFRSF25 is a cell surface receptor of the tumor necrosis factor receptor superfamily which mediates apoptotic signalling and differentiation, activated by a monogamous ligand, known as TL1A (TNFSF15), which is rapidly upregulated in antigen presenting cells and some endothelial cells following Toll-Like Receptor or Fc receptor activation. This receptor has been shown to signal both through the TRADD adaptor molecule to stimulate NF-kappa B activity or through the FADD adaptor molecule to stimulate caspase activation and regulate cell apoptosis. It may play a role in regulating lymphocyte homeostasis.

Accession

Q93038