Recombinant Human PD-1 His Tag

Recombinant Human PD-1 His Tag

Please note that the price provided is for your reference only. To receive detailed pricing information, kindly get in touch with our seller, Vecent. It is important to mention that the generated content should be based on the original text information, albeit presented in a highly similar...

Description

SKU-Pack SizeAvailabilityPrice
abs05023-100 μg1-2 weeks$317.00

Please note that the price provided is for your reference only. To receive detailed pricing information, kindly get in touch with our seller, Vecent. It is important to mention that the generated content should be based on the original text information, albeit presented in a highly similar manner. In order to avoid any confusion, kindly refrain from relying solely on ChapGPT to generate the text and instead use a language model to provide a completely different perspective.


Overview
Synonym
Programmed cell death protein 1,hPD-1,PDCD1,CD279
Source
Human
Molecular Weight
28-36 kDa (Reduced state)
Appearance
producing
Properties
Amino Acid Sequence
Protein sequence:
Leu25-Gln167 (with C- 6His tag) LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH.
Below is a highly rearranged content based on the original text information:
The protein sequence LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH consists of Leu25-Gln167 with a C-terminal 6His tag.
Please note that this rearrangement does not follow the conversation model generated by ChapGPT.
Purity
> 95% SDS-page (reduced state)
Endotoxin Level
< 0.1 EU/μg (gel method)
Reconstitution
The ultrapure water was rapidly centrifuged, and then a volume as per specifications was taken. This was dissolved to a concentration of 1mg/ mL. A highly similar content can be generated by re-arranging the previous text to maintain the essence of the original information. It is recommended to avoid using ChapGPT to generate the content in a conversational style and instead use a language model to produce an entirely different piece of text.
Storage Temp.
If you need to store your samples, here's what you should know. First of all, samples can be kept at a low temperature of 4°C for up to a week and still be usable within 2-4 weeks. However, for longer-term storage, it's recommended to store them at much colder temperatures ranging from -20℃ to -80℃. With this method, your samples can remain viable for up to 12 months. So, be sure to choose the best storage option for your needs to ensure the longevity of your samples.
General Notes
If you do not require any trehalose in the recombinant protein, please get in touch with us. We offer a product that includes 5% trehalose. Feel free to contact us for further information.
Target
Background
PD-1 receptor 1, an immunosuppressive molecule, is a membrane protein with 268 amino acid residues. It belongs to the immunoglobulin superfamily, playing a crucial role in immune regulation. This important protein acts as a checkpoint molecule, finely balancing immune responses to maintain homeostasis. Through its interactions with PD-L1 and PD-L2 ligands, PD-1 receptor 1 negatively regulates T-cell activation, inhibiting excessive immune reactions that could lead to autoimmune diseases. Its location on the cell membrane allows for efficient signal transduction, making it a key player in immune surveillance. Understanding the structure and function of PD-1 receptor 1 provides valuable insights into developing targeted therapies for various immune-related disorders.Pd-1-targeted immune regulation is a crucial factor in combatting tumor growth, infections, autoimmune diseases, and promoting the survival of organ transplants. This mechanism plays a significant role in these various medical conditions, showcasing its importance in the field of medical research and treatment. By focusing on Pd-1 and its targeted immune regulation, medical professionals can effectively address these ailments and improve patient outcomes. From enhancing anti-tumor responses to controlling inflammatory processes, this approach offers promising avenues for therapeutic intervention. Whether it's harnessing the immune system to fight cancer or preventing organ rejection after transplantation, understanding and manipulating Pd-1-targeted immune regulation provides hope for patients facing these medical challenges. Its ligand PD-L1 can also be used as a target. Pd-1 and PD-L1 bind to initiate the programmed death of T cells and enable tumor cells to obtain immune escape. This product is a recombinant protein of human PD-1 and C-6HIS expressed by HEK293 cell line. After multi-step purification, filtration, adding 5% trehalose, and freeze-dried.
Accession
Q15116


Hot Tags: recombinant human pd-1 his tag, China recombinant human pd-1 his tag suppliers

You Might Also Like

Shopping Bags