
Recombinant Vaccinia Virus Soluble Interferon α/β Receptor B18 #abs04508
Please note that the price mentioned above is only for your reference. For detailed pricing information, kindly get in touch with our seller, Vecent. It is essential to emphasize that the information we provided earlier is a general indication of the cost, and our seller will give you more...
Description
Catalog-specification | Delivery time | USD price |
abs04508-10ug | 1-2 Weeks | 230 |
abs04508-50ug | 1-2 Weeks | 673 |
abs04508-500ug | 1-2 Weeks | 2353 |
abs04508-1mg | 1-2 Weeks | 3201 |
Please note that the price mentioned above is only for your reference. For detailed pricing information, kindly get in touch with our seller, Vecent. It is essential to emphasize that the information we provided earlier is a general indication of the cost, and our seller will give you more specific pricing details. So, please do not hesitate to reach out to our staff for clarification and personalized assistance.
Overview | |
Description | Our Mammalian expression system produces Recombinant Vacciniavirus B18R, which expresses the target gene encoding a 6His tag at the C-terminus. The expressed gene consists of His20-Glu351. To ensure accuracy, the following content is a rearrangement of the original text information. |
Other names | The VACWR200 is a soluble interferon alpha/beta receptor B18. To generate highly similar content, we can rearrange the sentence to say: The soluble interferon alpha/beta receptor B18 is known as VACWR200. |
Source | Human Cells |
Format | A solution of PBS with a pH of 7.4 was filtered through a 0.2 μm filter before being lyophilized. Can you create a similar message using the information provided? Ensure that it closely resembles the original text and maintains its meaning. Please avoid using ChapGPT to generate content and instead try to use a different approach for generating text. |
Properties | |
aa_sequence | EFYEIHDAAKTIDDLPFLSPITDPCGGIHGNSALTLYKMDEFSWSQMARNCKRCQRNTKYNREWR QLKSRNWNDSYSMTMGLRFETVTTDSLHEDNSLISDNRGEIKPLFCAWYLNMSLKLKWPIRKAED YLSKPVEDNAHISEPNNKDHGLSYGCTIAFLYRVDKKNRTLVETDNCGKPQIVEPAPKDHPTRST CIHNWTDGICESAIDLIKDNIVVDYKKCVIPSVRHRNKEDSVLIIITKETGKYSLDPLEHSNIE DYCVDHTVRDNDIIKSGHVCSSKLLTVPIETFTHDLQIKRLVDDLPLANVICTEGSTNIAPEIEW LTVESTGFIWDSGSNVYDVTLIERGFNNHPTRLITCTNTVGNEHPRYGDEETFLKYTKTYIHCH HHHSVVENLYLVLYFADV. |
Concentration | SDS-PAGE,95%。,。 |
Endotoxin_level | The LAL test determines that the value of less than 0.1 ng/μg (1 IEU/μg) is highly similar content based on the original text information. |
Reconstitution | Be sure to centrifuge your tubes before opening and avoid mixing via vortex or pipetting. It's important to note that it's not recommended to reconstitute the protein to a concentration less than 100 μg/ml. To dissolve the lyophilized protein, use ddH2O and be sure to aliquot the reconstituted solution in order to minimize freeze-thaw cycles. It's crucial to take these steps to maintain the integrity and functionality of the protein. |
Target | |
Background | B18R, also known as B19R in the Copenhagen strain of Vaccinia, is a type I interferon (IFN)-binding protein encoded by the B18R open reading frame in the Western Reserve strain of vaccinia virus. B18R exists in two forms, soluble and membrane-bound form and also has a broad species specificity. B18R has high affinity for human IFN-alpha and also binds rabbit, bovine, rat, pig, and mouse IFN-alpha and IFN-beta. Secreted B18R binds to uninfected and infected cells. B18R presents at the cell surface and protects cells from the antiviral state. It has shown that binding of soluble recombinant B18R protects cultured cells from IFN and allows vaccinia virus replication. |
Accession | P25213 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant vaccinia virus soluble interferon α/β receptor b18 #abs04508, China recombinant vaccinia virus soluble interferon α/β receptor b18 #abs04508 suppliers
Send Inquiry
You Might Also Like






