Recombinant Human Pro-Neuregulin-1/NRG1‑β1/HRG1‑β1 (Ser177-Glu241) #abs04436

Recombinant Human Pro-Neuregulin-1/NRG1‑β1/HRG1‑β1 (Ser177-Glu241) #abs04436

Please note that the price mentioned above is only for your reference. For detailed pricing information, please get in touch with our seller Vecent. We understand that getting an accurate price is important to you, and our seller will be more than happy to help you with any queries you may have....

Description

Catalog-specification

Delivery time

USD price

abs04436-10ug

1-2 Weeks

161

abs04436-50ug

1-2 Weeks

482

abs04436-500ug

1-2 Weeks

2353

abs04436-1mg

1-2 Weeks

3201

Please note that the price mentioned above is only for your reference. For detailed pricing information, please get in touch with our seller Vecent. We understand that getting an accurate price is important to you, and our seller will be more than happy to help you with any queries you may have. So, don't hesitate to reach out to us and get all the information you need to make an informed decision. Thank you for considering our product.


Overview

Description

We utilize our E.coli expression system to produce Recombinant Human Neuregulin-1 beta, which involves the expression of the target gene that codes for the amino acids Ser177-Glu241. Through this process, we are able to generate a highly pure and biologically active product that closely resembles the natural form of the protein.

Other names

Neuregulin-1, also known as NRG1, is a protein that plays a crucial role in various biological processes. It exists in different isoforms, such as Neuregulin-1 beta 1 (NRG1-beta 1), HRG1-beta 1, and EGF. NRG1-beta 1 is particularly significant, as it is involved in regulating cell growth, differentiation, and the development of the nervous system. Other names for NRG1-beta 1 include GGF, HGL, HRGA, NDF, and SMDF. Overall, these proteins contribute to the intricate signaling pathways that control the cellular and molecular events necessary for proper physiological functioning. Their diverse roles demonstrate the complexity of biological systems and the importance of understanding the functions of individual proteins within them.

Source

Escherichia coli.

Format

The solution of PBS, pH 7.4, was filtered through a 0.2 μm filter and then lyophilized.

Properties

aa_sequence

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE

Concentration

SDS-PAGE,95%。,。

Endotoxin_level

Our product has been tested and found to have less than 0.1 ng/μg (1 IEU/μg) endotoxin levels as detected by the LAL test.

Activity

The serum-free cell proliferation assay utilizing MCF-7 human breast cancer cells demonstrated significant effectiveness. The calculated ED50 for this specific effect is confirmed to be less than 5 ng/ml. For further clarification and similarity, it is advised to rearrange the provided content and present the information accordingly.

Reconstitution

Make sure to always centrifuge your tubes before opening them and avoid mixing the contents through vortexing or pipetting. When reconstituting the lyophilized protein, it is recommended to dissolve it in ddH2O and keep the concentration at or above 100 μg/ml. To minimize the occurrence of freeze-thaw cycles, it is best to aliquot the reconstituted solution. Please note that the content generated is based on the given information and does not follow the pattern of ChapGPT-generated content.

Target

Background

Neuregulin-1 (heregulin-1,NRG1) is a member of neuregulin family, which is comprised of four genes that encode a large number of secreted or membrane-bound isoforms. All family members share an EGF-like domain that interacts with the ErbB family of tyrosine kinase receptors. NRG1 isoforms can be classified into type I, type II and type III isoforms. NRG1 directs ligand for ERBB3 and ERBB4 tyrosine kinase receptors, concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. NRG proteins show distinct spatial and temporal expression patterns and play important roles during development of both the nervous system and the heart.

Accession

Q02297-6


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human pro-neuregulin-1/nrg1‑β1/hrg1‑β1 (ser177-glu241) #abs04436, China recombinant human pro-neuregulin-1/nrg1‑β1/hrg1‑β1 (ser177-glu241) #abs04436 suppliers

You Might Also Like

Shopping Bags