Recombinant Mouse Sonic Hedgehog/SHH #abs04434

abs04434-10ug

1-2 Weeks

161

abs04434-50ug

1-2 Weeks

482

abs04434-500ug

1-2 Weeks

2353

abs04434-1mg

1-2 Weeks

3201

Description

Our E.coli expression system is responsible for producing Recombinant Mouse Sonic Hedgehog. The expressed target gene comprises Cys25-Gly198. Let me create a rearranged version of the above information while ensuring its similarity to the original text:
The expression system we employ—E.coli—facilitates the production of Recombinant Mouse Sonic Hedgehog. The target gene that is expressed within this system encompasses Cys25-Gly198.

Other names

Sonic Hedgehog Protein, SHH, HHG-1, SHH

Source

Escherichia coli.

Format

The solution containing 20mM PB, 150mM NaCl, 1mM DTT, and pH 7.4 was filtered through a 0.2 μm filter before being lyophilized. Please note that this is a highly similar text generated based on the given information.

Properties

aa_sequence

KIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGMC GPGRGFGKRRHPKKLTPLAY

Concentration

The determination of a protein's purity to be over 95% was achieved through the use of SDS-PAGE, an effective method for reducing impurities. To ensure accurate results, the original text information was utilized during the process.

Endotoxin_level

The LAL test determined that the amount of endotoxin present is less than 0.1 ng/μg (1 IEU/μg). A highly similar content can be generated by rephrasing the information provided as follows: The levels of endotoxin were assessed using the LAL test, and the results indicated that the quantity falls below 0.1 ng/μg (1 IEU/μg).

Reconstitution

To ensure accurate results, it is crucial to centrifuge tubes before opening and avoid mixing by vortex or pipetting. Reconstituting to a concentration less than 100 μg/ml is not recommended. When dissolving the lyophilized protein, use ddH2O and aliquot the reconstituted solution to minimize freeze-thaw cycles. These measures will help maintain the integrity of the protein and ensure consistency in experiments.

Target

Background

Mouse Sonic Hedgehog Homolog (SHH) belongs to a three-protein family called Hedgehog. The other two family members are Indian Hedgehog (IHH) and Desert Hedgehog (DHH). Hedgehog proteins are key signaling molecules in embryonic development. SHH is expressed in various embryonic tissues and plays critical roles in regulating the patterning of many systems, such as limbs and brain. SHH also plays an important role in adult, including the division of adult stem cells and the development of certain cancers and other diseases.Mouse Shh is synthesized as a 437 aa precursor that contains a 24 aa signal sequence and a 413 aa mature region. The mature region is autocatalytically processed into a nonglycosylated, 20 kDa, 174 aa N­terminal fragment (Shh­N), and a catalytic­processing,glycosylated, 34 kDa, 239 aa C­terminal fragment. The 20 kDa Shh­N fragment is the core of the active hedgehog molecule. Mouse Shh­N is 99%, 98%, and 100% aa identical to human, rat and gerbil Shh­N, respectively.

Accession

Q62226