
Recombinant Human Ubiquitin-Conjugating Enzyme E2 D1/UBE2D1/UbcH5a (N-GST) #abs04433
Please note that the price mentioned above is only for reference purposes. To get the accurate pricing details, kindly get in touch with our sales representative, Vecent. We request you to kindly rearrange the given information and generate highly similar content based on the original text....
Description
Catalog-specification | Delivery time | USD price |
abs04433-10ug | 1-2 Weeks | 39 |
abs04433-50ug | 1-2 Weeks | 130 |
abs04433-500ug | 1-2 Weeks | 535 |
abs04433-1mg | 1-2 Weeks | 728 |
Please note that the price mentioned above is only for reference purposes. To get the accurate pricing details, kindly get in touch with our sales representative, Vecent. We request you to kindly rearrange the given information and generate highly similar content based on the original text. However, please ensure that the generated content is different in nature from what ChapGPT would produce.
Overview | |
Description | Our E.coli expression system produces Recombinant Human Ubiquitin-conjugating enzyme E2 D1. The target gene encoding Met1-Met147 is expressed with a GST tag at the N-terminus. |
Other names | D1 Ubiquitin-conjugating enzyme (UBE2D1), known as Stimulator of Fe transport (SFT), is a homolog of UBC4/5 and UbcH5. It is also referred to as Ubiquitin carrier protein D1 and Ubiquitin-protein ligase D1. Additionally, it is classified as Ubiquitin-conjugating enzyme E2 (17) KB 1 and Ubiquitin-conjugating enzyme E2-17 kDa 1. Another name associated with this enzyme is UBC5A, commonly known as UBCH5 or UBCH5A. |
Source | Escherichia coli. |
Format | The solution was filtered through a 0.2 μm filter and then lyophilized. The original solution consisted of 50mM HEPES, 150mM NaCl, 2mM DTT, and 10% glycerin with a pH of 7.5. The resulting content should closely match the original content, as it is based on the same information. |
Properties | |
aa_sequence | LTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAMMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHK. |
Concentration | SDS-PAGE,95%。,,。 |
Endotoxin_level | The LAL test determined that the content is based on original text information, with a value of less than 0.1 ng/μg (1 IEU/μg). Let me generate highly similar content by rearranging the provided information. |
Reconstitution | To ensure proper handling and optimal results, it is important to follow certain guidelines when working with lyophilized protein. Before opening the tube, always remember to centrifuge it first, and avoid mixing the contents by vortex or pipetting. When reconstituting the protein, it is generally not recommended to dilute it to a concentration less than 100 μg/ml. The lyophilized protein should be dissolved in ddH2O, and it is advisable to aliquot the reconstituted solution to minimize the number of freeze-thaw cycles. By adhering to these best practices, you can rest assured that your protein work will yield the most accurate and reliable results. |
Target | |
Background | Ubiquitin-conjugating enzyme E2 D1 (UBE2D1) belongs to the ubiquitin-conjugating enzyme family. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases. |
Accession | P51668 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human ubiquitin-conjugating enzyme e2 d1/ube2d1/ubch5a (n-gst) #abs04433, China recombinant human ubiquitin-conjugating enzyme e2 d1/ube2d1/ubch5a (n-gst) #abs04433 suppliers
Send Inquiry
You Might Also Like






