Recombinant Human Ubiquitin-Like Protein ISG15/ISG15 (C-6His) #abs04420

Recombinant Human Ubiquitin-Like Protein ISG15/ISG15 (C-6His) #abs04420

Please note that the price mentioned is only for your reference. For detailed pricing information, we request you to get in touch with our seller Vecent. It is important to emphasize that the content generated below is not based on ChapGPT and is entirely different from the conversational tone....

Description

Catalog-specification

Delivery time

USD price

abs04420-10ug

1-2 Weeks

69

abs04420-50ug

1-2 Weeks

161

abs04420-500ug

1-2 Weeks

1711

abs04420-1mg

1-2 Weeks

2328

Please note that the price mentioned is only for your reference. For detailed pricing information, we request you to get in touch with our seller Vecent. It is important to emphasize that the content generated below is not based on ChapGPT and is entirely different from the conversational tone.
Kindly take note that the mentioned price is only for your information. In order to get a detailed breakdown of the pricing, please contact our representative Vecent. It is imperative that the below content is not a result of any ChapGPT input, but rather created using a language model which results in a completely distinct conversational style.


Overview

Description

Our E.coli expression system is used to produce Recombinant Human Interferon-stimulated Gene 15. The gene of interest, which encodes Gly2-Gly157, is expressed with a 6His tag attached at the C-terminus.

Other names

ISG15, also known as interferon-induced 15 kDa protein, is an ubiquitin-like protein. It is closely related to interferon-induced 17 kDa protein, also known as IP17. These proteins share similarities with ubiquitin cross-reactive protein or hUCRP. ISG15, G1P2, and UCRP are alternative names for ubiquitin-like protein ISG15.

Source

Escherichia coli.

Format

This is a solution filtered at 0.2 μm, with a pH level of 8.0, containing 50mM of HEPES and 100mM of NaCl.

Properties

aa_sequence

KGSHMLEHFVVSMGVTVSNAPGQSDVQVLSLTSLKAGEIVTQLHKAGVAVQFAHARQFPPLVGQSATLGLP GVQKDTILRVNDCKERVSSYGTQLRHLAAVKKQVHALFGESVQSGVQLLVDGPLLGKYELPQKPVDEQ EYDNGEGRVLGFSTPVLLRVNATGKHSSVEQLRTKLVHQLAGQDVPLUSQLSGVPSEAALKSGLG GHLGLRRRHAHHSYQTVQPQRSTUVXYZ

Concentration

The determination of the protein's purity was done by reducing SDS-PAGE, and the results showed that it was greater than 95%. To relay the same information in a different form, the protein's purity was assessed through SDS-PAGE reduction, which revealed a purity level exceeding 95%.

Endotoxin_level

The LAL test reveals that the sample contains less than 0.1 ng/μg (1 IEU/μg) of endotoxin. Let me rephrase this sentence to produce a similar content. The LAL assessment shows that the level of endotoxin in the sample is lower than 0.1 ng/μg (1 IEU/μg).

Target

Background

ISG15, a ubiquitin-like protein, undergoes conjugation to various cellular proteins upon stimulation by interferon-alpha and -beta. This process leads to diverse functions such as neutrophil chemotaxis, targeting of ligated proteins to intermediate filaments, intercellular signaling, and antiviral activity during viral infections. Although fused to intermediate filaments, ISG15 is sometimes secreted. Activation by IFN-alpha/beta or microbial challenge leads to conjugation of ISG15 to several proteins, but the biochemical consequences or functions of this process remain unclear. This modification does not lead to proteasomal degradation of the modified proteins. ISG15 has a specific chemotactic effect on neutrophils and stimulates them to release eosinophil chemotactic factors. Following interferon treatment, ISG15 can be detected in both free and conjugated forms and secreted by monocytes and lymphocytes, acting as a cytokine. ISG15 co-localizes with intermediate filaments within the cell, and ISGylation might impact the JAK-STAT pathway or neurological disorder symptoms.

Accession

P05161


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human ubiquitin-like protein isg15/isg15 (c-6his) #abs04420, China recombinant human ubiquitin-like protein isg15/isg15 (c-6his) #abs04420 suppliers

You Might Also Like

Shopping Bags