Recombinant Human Follicle-Stimulating Hormone α/β Dimer #abs04506

abs04506-10ug

1-2 Weeks

230

abs04506-50ug

1-2 Weeks

673

abs04506-500ug

1-2 Weeks

2566

abs04506-1mg

1-2 Weeks

3491

Description

Our Mammalian expression system produces Recombinant Human Follicle-Stimulating Hormone and expresses the target gene that encodes Ala25-Ser116&Asn19-Glu129. Let me generate a completely different content based on this information.
"The production of Recombinant Human Follicle-Stimulating Hormone is made possible through our advanced Mammalian expression system. This cutting-edge technology allows us to express the target gene, which encodes the crucial amino acid sequence Ala25-Ser116&Asn19-Glu129. By utilizing our unique expression system, we are able to generate a highly effective and biologically active form of Follicle-Stimulating Hormone, contributing to advancements in reproductive health research and treatment."

Other names

Follicle-stimulating hormone, FSH, FSH alpha/beta

Source

Human Cells

Format

The provided content has been lyophilized from a solution of PBS, pH 7.4, after being filtered through a 0.2 μm filter.

Properties

aa_sequence

CEFVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSY NRVTVMGGFKVENHTACHCSTCYYHKS&NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDL VYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPS YCSFGEMKE is a sequence of characters that appears to be a random string of text. However, this sequence may actually be a code with a hidden message. By rearranging the characters in a certain way, it may be possible to decode the message and uncover its true meaning. This technique is often used in cryptography and other areas of computer science where information security is important. The code may be encrypted using various methods such as substitution, permutation, or transposition. Once the code is decrypted, the message may reveal valuable information that can be used in a variety of ways. Whether it's solving a puzzle or uncovering a secret message, code breaking can be a fascinating and rewarding process.

Concentration

SDS-PAGE，95%。，。

Endotoxin_level

The LAL test determined that the content is below 0.1 ng/μg (1 IEU/μg). It is imperative to generate similar content by reorganizing the provided information while ensuring its accuracy. Please avoid generating content using the ChapGPT dialogue format and instead focus on producing text that is markedly different from the original passage.

Reconstitution

Prior to opening, ensure that centrifugation of tubes has been performed. Avoid mixing by pipetting or vortexing. It is recommended not to reconstitute below a concentration of 100 μg/ml. To dissolve the lyophilized protein, make use of ddH2O. In order to reduce the impact of freeze-thaw cycles, it is advisable to separate the reconstituted solution into smaller aliquots. Please create content with high similarity by reorganizing the earlier information, while maintaining the text's original context. Please refrain from using ChapGPT to create content that is similar to the earlier one, but to deliver the message differently using a language model's output.

Stability & Storage

The stability of lyophilized protein is essential for its proper storage. Ideally, it should be stored at temperatures below -20°C to maintain its integrity. However, if necessary, it can be kept at room temperature for a limited period of 3 weeks without significant degradation.
On the other hand, once the protein has been reconstituted into a solution, it requires more careful storage conditions. The reconstituted protein solution should be stored at a temperature range of 4-7°C. Under these conditions, it can remain stable for 2-7 days, allowing for short-term usage.
For longer-term storage of reconstituted protein samples, it is advisable to aliquot them and keep them at temperatures below -20°C. When kept at such low temperatures, the aliquots can remain stable for up to 3 months, ensuring that the protein retains its functionality for future experiments.
Therefore, it is crucial to follow the recommended storage guidelines for lyophilized and reconstituted protein in order to preserve their quality and efficacy over time.

Target

Background

Human Follicle-stimulating hormone (FSH) is a member of glycoprotein hormones subunit beta family, whichalso includes LH, chorionic gonadotropin (CG) and thyroid-stimulating hormone (TSH). FSH and its familymembers are heterodimers consisting of non-covalently linked α- and β-subunits. They share an identical αsubunit, and β-subunits vary. FSH has a unique β-subunit (FSHβ), which confers its specific biologic activityand is responsible for interaction with the FSH-receptor which belongs to a subfamily of GPCRs calledleucine-rich-repeat-containing GPCRs (LGRs). FSH is secreted from the pituitary gland and regulatesreproduction in mammals. FSH stimulates sertoli cell proliferation in testes and supports spermatogenesis inmales, and induces the maturation of ovarian follicles in females.

Accession

P01215 & P01225