
Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-2/HER2 (C-6His) #abs04564
Please note that the price provided is only for your reference and for further details, kindly reach out to our seller, Vecent. Additionally, it is important to emphasize that the content generated should not be based on the approach of ChapGPT, instead, a completely distinct language model...
Description
Catalog-specification | Delivery time | USD price |
abs04564-10ug | 1-2 Weeks | 146 |
abs04564-50ug | 1-2 Weeks | 382 |
abs04564-500ug | 1-2 Weeks | 2353 |
abs04564-1mg | 1-2 Weeks | 3201 |
Please note that the price provided is only for your reference and for further details, kindly reach out to our seller, Vecent. Additionally, it is important to emphasize that the content generated should not be based on the approach of ChapGPT, instead, a completely distinct language model should be utilized to ensure uniqueness in the generated text.
Overview | |
Description | Our Mammalian expression system produces Recombinant Human Receptor tyrosine-protein kinase ErbB-2. The target gene, which encodes Thr23-Thr652, is expressed with a 6His tag at the C-terminus. |
Other names | HER2, also known as receptor tyrosine-protein kinase erbB-2 or proto-oncogene Neu, is a vital protein involved in cell signaling pathways. It is a type of tyrosine kinase-type cell surface receptor. HER2 plays a crucial role in various cellular processes and is particularly associated with tumorigenesis and metastasis. |
Source | Human Cells |
Format | The content was prepared by freeze-drying a solution of PBS with a pH of 7.4, which was passed through a 0.2 μm filter to ensure its purity. Can you please provide further details or context for this information? |
Properties | |
aa_sequence | ACGTYLHQMHLLPSPQTVELSPEEDALPVDHHLQDALSRRLSPLVLDMQTLYIVGVDVDTGPCTG LENAQVQENTEQQVVITQFCRGNAGPYHVQLALPVDTGPGTVLSKITSEEQLQGQKGVPNRLVCV VAHLYCQTDNQIWLKFYTDVRNLLLQPTCPPSMCAHSRANQDTSRKPLCACGMTSEECQGQSRD QVGHCGHKQTCDTRALPGTLEQACGSPLPMPLQVLNLDYGQAFYECTFGCSAAPCSTTVSCLDT VSRATLGAAVVPVEDGQSVDRGCEFCAQCSGCKPNMAPCCRTYCSEYMTVHGHCEDSTPHPADT NPDMSVQGAFVCQTVPTYGTSSLVVGCQGLRLFGDLLPHTELGMQPTEQLFDFIQVSLLVDRS SLAAPMVMEIQLHQNGTILLSLAGHLYSWGQETTQLRREVPQSGASIPEGSSSHTPHHHMQ.HP VTQCLCLRALEEPATNPPRFDALHDLVRCLVGKKVVLGQTDIYCNEIQLPLECFNLHLLVTGT FHSWNTALKLQALNULLQLRIDATVQCWCPGLHTCAPESCSMCGSTRCWLHQDGNRLVSGESED GLDPCKGGACRHKSLCLGTHNPPLACTADEQCDLNPEACRYFGFSVTCPVTLTVDASSAVTNHP EYHYMSENCYGSCTTVNGLPQVQPEQVAEGQKGVACSSIGEEQAPNPLQVFFTTEVDEGISLY LPDWVDSQFFLINVLQIRNYAGRIHISTFTLGMSWLGRSLAVRRGSGelHDANFHFSLIYQAL TFDLPQGLCHPGGVRPLQ.PTYNSWALQDCVGREHMFIREGLKCIQVVRDRIYNGALPEGDSNLSN. |
Concentration | The level of purity of our sample was verified to be greater than 95% through the use of SDS-PAGE gel electrophoresis. In order to produce a similar but distinct piece of content, we could rephrase the statement as follows: The SDS-PAGE gel electrophoresis experiment we conducted confirmed that our sample's purity exceeded 95%. |
Endotoxin_level | As determined by the LAL test, the level of less than 0.1 ng/μg (1 IEU/μg) is found. |
Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Target | |
Background | Human epidermal growth factor receptor 2 (HER2) is a type of membrane glycoprotein, and belongs to the epidermal growth factor (EGF) receptor family. HER2 plays a key role in development, cell proliferation and differentiation. HER2 has been reported to associate with malignancy and a poor prognosis in numerous carcinomas, including breast, prostate, ovarian, lung cancers and so on. HER2 is activated by dimerization and not activated by EGF, TGF-alpha and amphiregulin. Interaction with PTK6 increases its intrinsic kinase activity.It is heterodimer with EGFR, ERBB3 and ERBB4. HER2 associates with the 5'-TCAAATTC-3' sequence in the PTGS2/COX-2 promoter and activates its transcription. It implicated in transcriptional activation of CDKN1A and the function of the protein involves STAT3 and SRC. And also it involved in the transcription of rRNA genes by RNA Pol I and enhances protein synthesis and cell growth. |
Accession | P04626 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human receptor tyrosine-protein kinase erbb-2/her2 (c-6his) #abs04564, China recombinant human receptor tyrosine-protein kinase erbb-2/her2 (c-6his) #abs04564 suppliers
Send Inquiry
You Might Also Like






