
Recombinant Human T-cell Surface Protein Tactile/CD96(C-6His) #abs04560
Please note that the price mentioned is just for your information. Kindly get in touch with our seller Vecent for the detailed price. It is essential to generate content that is highly similar to the original text by rearranging the sentences and using the same context. Please refrain from using...
Description
Catalog-specification | Delivery time | USD price |
abs04560-10ug | 1-2 Weeks | 46 |
abs04560-50ug | 1-2 Weeks | 138 |
abs04560-500ug | 1-2 Weeks | 917 |
abs04560-1mg | 1-2 Weeks | 1382 |
Please note that the price mentioned is just for your information. Kindly get in touch with our seller Vecent for the detailed price. It is essential to generate content that is highly similar to the original text by rearranging the sentences and using the same context. Please refrain from using ChapGPT to generate text and use language models to create entirely different dialogue.
Overview | |
Description | Our Mammalian expression system is responsible for the production of Recombinant Human T-cell Surface Protein Tactile, wherein the target gene encoding Val22-Met503 is expressed with a 6His tag at the C-terminus. To ensure similarity with the original text information, the content can be rearranged to convey this same message in a different way. |
Other names | The protein known as T-cell surface protein tactile is also referred to as cell surface antigen CD96 or CD96 for short. This protein is expressed later in the activation process of T-cells and plays a crucial role in their functioning. |
Source | Human Cells |
Format | The solution was filtered through a 0.2 μm filter and then subjected to lyophilization. The pH of the solution was maintained at 7.4 with the use of PBS. To create a similar content, the original text has been rearranged while retaining the essential information. |
Properties | |
aa_sequence | AEGVPYNTTIIWIYDKSYQMHTNHPTEVQPNYRWCHTHKSNEMGWKPQGSFEVHVPWCRVFEMTI TPKGKQPWNDYGKLFNTMINWQSHEAMCDGSPGVSLSSIHFSPTEGISSHCQGNPAAAQVFKIFF QDMVYWKWRPSPINIPKPLPEYSTYFDDNYRGEKNWVRDLIAVTTGSVPVVEKINELQTHLQGST CRKTVYIQDVRNKFFLHGSFPKTLSSGVKWEIDLPIEIWHDYSKDSEKVGCREPGVMTLENYNIY LTVHNEFIDGNSWSSVQFGTKQVEQKANIKSITFSILPQYPTVWPSSSQTYGHPNVFTSNLRLYV DNAPNIKRSKQGRTINKILEHSHVRLINTLWFWSGLTTQLGKEPMQRIDFSVKPVKLNGNGTHPLV LSPVYPTSEKFTRSPVQTSPVGNWKNDIYISGKTLVVWSSILELKSNPSSDIVIENKAVISIKPS VEIVTLNLRPSTSPPMTADDLTVSGPSANCNEGSSTRPVTITYLGYVDNPKHSRGHYHMKFKDMT |
Concentration | SDS-PAGE,95%。,。 |
Endotoxin_level | The LAL test has determined that the level of contamination is less than 0.1 ng/μg (1 IEU/μg). This means that the sample is highly purified and free from any impurities or endotoxins. |
Reconstitution | Prior to opening, always take the precaution of centrifuging the tubes. It is advised to abstain from mixing by vortex or pipetting. It is further recommended that you do not reconstitute to a concentration lower than 100 μg/ml. The lyophilized protein should be dissolved in ddH2O. We recommend taking caution by aliquoting the reconstituted solution to minimize the effects of freeze-thaw cycles. Please note, adopt a unique approach in conveying the message while retaining the same content. |
Target | |
Background | The cluster of differentiation (CD) system is commonly used as cell markers in immunophynotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules which associating with the immune function of the cell. The CD155 ligand CD96 is a member of the Ig superfamily. It's a immunoglobulin-like protein tentatively allocated to the repertoire of human NK receptors. NK cells recognize poliovirus receptor (PVR), anectins and nectin-like protein family member serve to mediate cell-cell adhesion, cell migration, with the presence of an additional receptor, CD96. CD96 promotes NK cell adhesion to target cells expressing PVR, stimulates cytotoxicity of activated NK cells, and mediates acquisition of PVR from target cells. |
Accession | P40200-2 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human t-cell surface protein tactile/cd96(c-6his) #abs04560, China recombinant human t-cell surface protein tactile/cd96(c-6his) #abs04560 suppliers
Send Inquiry
You Might Also Like






