
Recombinant Human Arginase-1/ARG1(C-6His) #abs04565
Please note that the price provided above is only for your reference. For more detailed pricing information, we kindly request you to get in touch with our seller Vecent. This product is for research use only, not for use in diagnostic prodecures or in human.
Description
Catalog-specification | Delivery time | USD price |
abs04565-10ug | 1-2 Weeks | 275 |
abs04565-50ug | 1-2 Weeks | 825 |
abs04565-500ug | 1-2 Weeks | 3742 |
abs04565-1mg | 1-2 Weeks | 5091 |
Please note that the price provided above is only for your reference. For more detailed pricing information, we kindly request you to get in touch with our seller Vecent.
Overview | |
Description | Our Mammalian expression system is utilized to produce Recombinant Human Arginase-1. The target gene, which encodes Met1-Lys322, is expressed with a 6His tag positioned at the C-terminus. It is important to rearrange the information from the original text and ensure that the generated content closely resembles the original information. However, please note that the approach used in generating content will be different from the manner in which ChapGPT produces dialogue. |
Other names | ARG1, also known as liver-type arginase or Type I arginase, is an enzyme called arginase-1. |
Source | Human Cells |
Format | This solution is composed of 10mM Tris-HCl, 1mM 2-mercaptoethanol, 2mM MnCl2, and 150mM NaCl, all filtered through a 0.2 μm filter. The final pH is 7.5. |
Properties | |
aa_sequence | GLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPKHHH MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQ IVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDIN TPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGI KYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYI |
Concentration | SDS-PAGE,95%。 |
Endotoxin_level | The LAL test has determined that the concentration of endotoxin in the sample is less than 0.1 ng/μg (equivalent to 1 international endotoxin unit per microgram). |
Target | |
Background | ARG1 belongs to the ureohydrolase enzyme family and has the ability to hydrolyze arginine into urea and ornithine. Within the urea cycle, ARG1 is responsible for the fifth and final step, a crucial process that helps to eliminate harmful ammonia from the body. Although mainly found in the liver, this cytosolic enzyme is also expressed in non-urea cycle-containing cells and tissues, such as the lungs. In cases where ARG1 is inherited deficient, argininemia may result, which is an autosomal recessive disorder characterized by high levels of ammonia in the body. |
Accession | P05089 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human arginase-1/arg1(c-6his) #abs04565, China recombinant human arginase-1/arg1(c-6his) #abs04565 suppliers
Send Inquiry
You Might Also Like
-

Recombinant Human Syndecan-1/SDC1/CD138 (C-6His) #ab...
-

Recombinant Mouse Macrophage Metalloelastase/MMP12 (...
-

Recombinant Human Coagulation Factor III/Tissue Fact...
-

Recombinant Human Fatty Acid-Binding Protein 4/FABP4...
-

Recombinant Human Cu/Zn SOD, His #abs01227
-

Recombinant Human Neuritin #abs00933
