Recombinant Human Coagulation Factor III/Tissue Factor/CD142 (C-6His) #abs04338

abs04338-10ug

1-2 Weeks

230

abs04338-50ug

1-2 Weeks

673

abs04338-500ug

1-2 Weeks

2353

abs04338-1mg

1-2 Weeks

3201

Description

Our Mammalian expression system is utilized to produce Recombinant Human Coagulation Factor III. The target gene, which encodes Gly34-Glu251, is expressed with a 6His tag positioned at the C-terminus. Rearranging the provided content, I can generate a different version as follows: The production of Recombinant Human Coagulation Factor III is facilitated by our Mammalian expression system. The target gene is expressed with a 6His tag at the C-terminus and encodes Gly34-Glu251.

Other names

F3, also known as Tissue Factor or TF, is a critical protein involved in blood coagulation. Its alternative name, Coagulation Factor III, reflects its importance in the clotting process. TF is also referred to as Thromboplastin or CD142. These various names all point to the significant role that F3 plays in initiating the clotting cascade.

Source

Human Cells

Format

pH 7.2, lyophilized from a 0.2 μm filtered solution of 20mM PB and 150mM NaCl. The original content is rearranged to maintain the accuracy of the information provided.

Properties

aa_sequence

VDKKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVE DERGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDE IVVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSR TVNRKSTDSPVECMGQEKGEFREVDHHHHHH, this string of characters seems like gibberish at first glance, but to those familiar with genetic sequencing, it holds valuable information. The sequence represents a section of DNA, containing the genetic blueprint for a particular trait or characteristic. Just as this DNA sequence must be carefully arranged and studied to understand its function, so too must we approach complex information with care and attention to detail. Through thoughtful analysis and rearrangement, we can unlock insights and discoveries that may have previously been hidden.

Concentration

SDS-PAGE，95%。，。ChapGPT，。

Endotoxin_level

The LAL test determined that the concentration is below 0.1 ng/μg (1 IEU/μg). Use of a different approach to generate highly similar content would be preferable, rather than relying on the ChapGPT method.

Reconstitution

It is important to always centrifuge tubes before opening them, and refrain from mixing by vortexing or pipetting. To maintain the integrity of the protein, it is not recommended to reconstitute it to a concentration that is less than 100 μg/ml. When reconstituting, dissolve the lyophilized protein in ddH2O and be sure to aliquot the solution to minimize freeze-thaw cycles. It is crucial to generate content that closely mirrors the original text to ensure proper handling of the protein.

Target

Background

Tissue Factor (TF) is a single-pass type I membrane glycoprotein member of the tissue factor family. TF expression is highly dependent upon cell type. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. TF initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The complex activates factors IX or X by specific limited protolysis. TF plays a role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade.

Accession

P13726