
Recombinant Human Interleukin-17D/IL-17D #abs04209
Please note that the price mentioned above is for reference purposes only. For detailed pricing information, we encourage you to get in touch with our seller Vecent. Rest assured that they will provide you with all the details you need. It's always best to speak directly with our sales team to...
Description
Catalog-specification | Delivery time | USD price |
abs04209-10ug | 1-2 Weeks | 161 |
abs04209-50ug | 1-2 Weeks | 482 |
abs04209-500ug | 1-2 Weeks | 2139 |
abs04209-1mg | 1-2 Weeks | 3201 |
Please note that the price mentioned above is for reference purposes only. For detailed pricing information, we encourage you to get in touch with our seller Vecent. Rest assured that they will provide you with all the details you need. It's always best to speak directly with our sales team to get an accurate quote. So, reach out to us today and let us help you find the perfect solution for your needs.
Overview | |
Description | Our E.coli expression system is responsible for producing Recombinant Human Interleukin-17D, in which the target gene encoding Ala18-Pro202 is expressed. |
Other names | Interleukin-17D; IL-17D; IL17D |
Source | Escherichia coli. |
Format | The solution containing 4mM HCl was filtered through a 0.2 μm filter and then lyophilized. Can you give me more information about this process? |
Properties | |
aa_sequence | ADGRCGPRGARRAGRSPERPDLARPQEGECLALQGHLAAFGVSLQHHTPRENGSCAAPDPRGARR PTPRFVYSSWARYRPSYLPEARYLCCLGCREGFEDVPYMTRSVLPTCAGGRYVTEAVTYIPGVCE PEKPDSIDSAKQSILGDLPAGAAPRRLQGLLHVEQLYLRAAGFSTAHLQLGPAEQARSACPGGPRAD |
Concentration | The level of purity was determined to be above 95% through the use of reduced SDS-PAGE. To create a similar statement, one could rearrange the wording and say: Using reduced SDS-PAGE, it was determined that the purity level exceeded 95%. |
Endotoxin_level | The LAL test has determined that the concentration of endotoxin in the substance is less than 0.1 ng/μg (1 IEU/μg). |
Reconstitution | Before opening, make sure to centrifuge the tubes. Avoid mixing via vortex or pipetting methods. It is not advisable to reconstitute the protein to a concentration lower than 100 μg/ml. Use ddH2O to dissolve the lyophilized protein. To avoid damage, divide the reconstituted solution into smaller portions and minimize freeze-thaw cycles. Please refrain from using ChapGPT to generate similar content; instead, speak using a completely different approach based on the original text information. |
Stability & Storage | If you have lyophilized protein, it's best to store it at a temperature below -20°C. However, if you do need to keep it at room temperature, it should be stable for up to three weeks. Once you've reconstituted the protein, you can store the solution at a temperature between 4-7°C for 2-7 days. If you want to keep the protein solution for longer, make sure to store it at a temperature below -20°C, and divide the solution into smaller aliquots to ensure stability for up to three months. |
Target | |
Background | The Interleukin-17 family encompasses six proteins (IL-17, IL-17B through IL-17F) that share a similar structure and the ability to induce local cytokine production. While the C-terminus contains a conserved cysteine-knot fold, there is considerable divergence at the N-terminus. IL-17D is the most closely related to IL-17B with a 27% sequence homology. It is predominantly expressed in tissues such as skeletal muscle, heart, adipose tissue, lung, pancreas, and nervous system. As with other members of the IL-17 family, IL-17D modulates immune responses indirectly by stimulating the production of myeloid growth factors and chemokines including IL-6, IL-8, and GM-CSF. In addition, IL-17D has been found to suppress the proliferation of myeloid progenitors in colony formation assays. |
Accession | Q8TAD2 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human interleukin-17d/il-17d #abs04209, China recombinant human interleukin-17d/il-17d #abs04209 suppliers
Send Inquiry
You Might Also Like






