
Recombinant Human Fibroblast Growth Factor 7/FGF-7/KGF #abs04211
Please note that the price mentioned is only for reference purposes. To obtain detailed pricing information, please get in touch with our sales representative Vecent. It's important to understand that the content generated should be similar to the original text, but expressed in a different way...
Description
Catalog-specification | Delivery time | USD price |
abs04211-10ug | 1-2 Weeks | 230 |
abs04211-50ug | 1-2 Weeks | 673 |
abs04211-500ug | 1-2 Weeks | 2353 |
abs04211-1mg | 1-2 Weeks | 3491 |
Please note that the price mentioned is only for reference purposes. To obtain detailed pricing information, please get in touch with our sales representative Vecent. It's important to understand that the content generated should be similar to the original text, but expressed in a different way using a language model. Hence, refrain from using the ChapGPT generated text format and focus on creating unique content.
Overview | |
Description | Our E.coli expression system ensures that Recombinant Human Fibroblast Growth Factor 7 is produced, with the target gene encoding Cys32-Thr194 being expressed. This generates a highly similar product that maintains the original content of the gene sequence. We take pride in delivering high-quality products that meet the expectations of our customers. |
Other names | ,,:"FGF-7, also known as fibroblast growth factor 7 or heparin-binding growth factor 7, is commonly referred to as KGF or keratinocyte growth factor. It is a protein that plays a crucial role in promoting the growth and development of keratinocytes, which are the main cells found in the outer layer of the skin. FGF-7 is also known for its ability to bind to heparin, a type of carbohydrate molecule, which helps in regulating its activity and function. The discovery of FGF-7 has opened up new possibilities for therapeutic applications in wound healing and tissue regeneration." |
Source | Escherichia coli. |
Format | The solution of 20mM PB, pH 8.0 and 50mM NaCl was filtered through a 0.2 μm filter, then lyophilized to form a powder. A highly similar content can be written as follows: After filtering a solution containing 20mM PB at pH 8.0 and 50mM NaCl through a 0.2μm filter, the resulting fluid was freeze-dried to create a dry powder. |
Properties | |
aa_sequence | EMYDNYSYHSRTRVTGNVMAQPEQTCNCSSPERKGKVQTQDGKVIDKRLRFWWYLTENNNMEIMR YDIMGGVERRLLFCQMKWYLIAKEGTVEENFYSNCEDKGEKLALKNHIYTFANAGVSWWMGNGH FTIPVAKNLQGGRKKHKATKQEETAKFHL.Please note that the content above is solely generated by AI and might not make any sense. |
Concentration | The level of purity observed through SDS-PAGE reduction is greater than 95%. A closely resembling version of this information can be produced by rearranging the original text. |
Endotoxin_level | The LAL test determined that the content is less than 0.1 ng/μg (1 IEU/μg). Let's generate a highly similar content by rearranging the information. |
Activity | The functional ELISA assay was used to measure the binding ability of this protein to Human FGFR3. The result showed that the ED50 for this effect is less than 1 ug/ml, indicating a high binding affinity. In summary, this protein is a potent binder of Human FGFR3 in vitro. |
Reconstitution | Before opening, always make sure to centrifuge tubes. Avoid mixing by vortexing or pipetting. It is important to note that reconstituting the protein to a concentration below 100 μg/ml is not recommended. Instead, dissolve the lyophilized protein in ddH2O. To prevent degradation, it is advisable to aliquot the reconstituted solution and minimize freeze-thaw cycles. For a distinct approach, the following content has been generated based on the original information provided. |
Stability & Storage | To maintain the stability of lyophilized protein, it should be kept at a temperature below -20°C. However, it can still be stored at room temperature for up to 3 weeks. Once reconstituted, the protein solution should be refrigerated at temperatures between 4-7°C for a period of 2-7 days. For longer-term storage, it is recommended to aliquot the reconstituted samples and store them at a temperature below -20°C for a maximum of 3 months. By following these recommended storage guidelines, the quality and integrity of the protein sample can be maintained. |
Target | |
Background | Fibroblast growth factor 7 (FGF7) is a secreted protein which is mainly located in epithelial cells and belongs to the heparin-binding growth factors family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF7 is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. It is possible major paracrine effector of normal epithelial cell proliferation. |
Accession | P21781 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human fibroblast growth factor 7/fgf-7/kgf #abs04211, China recombinant human fibroblast growth factor 7/fgf-7/kgf #abs04211 suppliers
Send Inquiry
You Might Also Like






