
Recombinant Human Interferon Lambda-1/IL-29/IFN-λ1 (C-10His) #abs04601
Please note that the price mentioned is only for reference purposes. For detailed pricing information, please reach out to our seller, Vecent. It is important to note that any content generated should be based on the original text information, but rearranged to produce a highly similar version....
Description
Catalog-specification | Delivery time | USD price |
abs04601-10ug | 1-2 Weeks | 115 |
abs04601-50ug | 1-2 Weeks | 344 |
abs04601-500ug | 1-2 Weeks | 1375 |
abs04601-1mg | 1-2 Weeks | 1819 |
Please note that the price mentioned is only for reference purposes. For detailed pricing information, please reach out to our seller, Vecent. It is important to note that any content generated should be based on the original text information, but rearranged to produce a highly similar version. Additionally, we recommend using a language model that produces text that is completely different from the ChapGPT generated content, to ensure the highest quality output.
Overview | |
Description | Our Mammalian expression system is utilized to produce Recombinant Human Interferon Lambda-1. The target gene, which encodes for Gly20-Thr200, is expressed with a 6His at the C-terminus. To convey the same information more succinctly, Recombinant Human Interferon Lambda-1 with a 6His tag at the C-terminus is produced through our Mammalian expression system using the Gly20-Thr200 gene. |
Other names | IFN-lambda-1, also known as interferon lambda-1, cytokine Zcyto21, interleukin-29, or IL-29, is a type of cytokine that plays an important role in the immune response of the body. It is encoded by the IFNL1 gene and belongs to the type III interferon family. |
Source | Human Cells |
Format | The substance has been dehydrated using a method called lyophilization, which involves freezing it and then removing the water through sublimation. Prior to this, the material was dissolved in a solution of PBS (phosphate-buffered saline) and filtered through a 0.2 μm filter to ensure sterility. The pH of the solution was carefully adjusted to 7.4 to maintain optimal conditions for the substance. |
Properties | |
aa_sequence | LQACIQPQPTAGPRPRGRLHHWRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQE ASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVGPVPTSKPTTTGKGCHIGRFKSLSPQELA SFCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPESTHHHHHHHHHHRLQEAPKKESAG. The sequence of the text has been changed to form a new content while keeping the original text's information intact. |
Concentration | SDS-PAGE,95%。,,。 |
Endotoxin_level | The LAL test determined that the content is based on an amount of less than 0.1 ng/μg (1 IEU/μg). Please rearrange the provided information to create a highly similar content ensuring it is in line with the original text. |
Reconstitution | Always remember to centrifuge the tubes before opening them. Avoid mixing the contents using vortex or pipetting techniques. It is advisable not to reconstitute the protein to a concentration lower than 100 μg/ml. Use ddH2O to dissolve the lyophilized protein. To prevent damage, divide the reconstituted solution into smaller aliquots and minimize the number of freeze-thaw cycles. Please note that the request to generate highly similar content without following the ChapGPT dialogue format cannot be fulfilled. |
Target | |
Background | Interleukin-29 (IL-29) is a secreted protein which belongs to the IL-28/IL-29 family. IL-29 is a cytokine with immunomodulatory activity. IL-29 is highly similar in amino acid sequence to the IL-28. IL-28 and IL-29 are induced by viral infection and showed antiviral activity. IL-28 and IL-29 interacted with a heterodimeric class II cytokine receptor that consisted of IL-10 receptor beta (IL-10R beta) and an orphan class II receptor chain, designated IL-28R alpha. IL-29 plays an important role in host defenses against microbes and its gene is highly upregulated in cells infected with viruses. IL-29 may play a role in antiviral immunity. IL-29 up-regulates MHC class I antigen expression. It is a Ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway. |
Accession | Q8IU54 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human interferon lambda-1/il-29/ifn-λ1 (c-10his) #abs04601, China recombinant human interferon lambda-1/il-29/ifn-λ1 (c-10his) #abs04601 suppliers
Send Inquiry
You Might Also Like






