
Recombinant Human Natural Killer Cells Antigen CD94/CD94 (N-6His) #abs04604
Please note that the price mentioned above is only for your reference. For detailed pricing information, please get in touch with our seller, Vecent. It is important to emphasize that the content generated should be highly similar to the original text and rearranged in a way that maintains the...
Description
Catalog-specification | Delivery time | USD price |
abs04604-10ug | 1-2 Weeks | 161 |
abs04604-50ug | 1-2 Weeks | 482 |
abs04604-500ug | 1-2 Weeks | 2353 |
abs04604-1mg | 1-2 Weeks | 3201 |
Please note that the price mentioned above is only for your reference. For detailed pricing information, please get in touch with our seller, Vecent. It is important to emphasize that the content generated should be highly similar to the original text and rearranged in a way that maintains the integrity of the information provided. As an AI language model, I will generate content that is distinct from ChapGPT's conversational approach.
Overview | |
Description | Our Mammalian expression system produces Recombinant Human Natural Killer Cells Antigen CD94, with the target gene encoding Ser34-Ile179 expressed at the N-terminus with a 6His tag. To ensure accurate information, please note that the generated content will be significantly different from the original text. |
Other names | One of the important antigens found on natural killer cells is CD94. This antigen is also known as KP43 and is a member of the killer cell lectin-like receptor subfamily D. CD94 is also referred to as NK cell receptor and KLRD1. |
Source | Human Cells |
Format | The solution was filtered through a 0.2 μm filter before being lyophilized. The lyophilization process was carried out on a PBS solution with a pH value of 7.4. |
Properties | |
aa_sequence | LSICFKPFTSNIELQKHEMTKWGYNFSEQQNCCSCQERYTPNCWSYISEASLLQLQNSDPGNIDF KSSSHEQFYWISTSYEEWLPAGRASLQNTFTFSPYIFQTNCAYNLNGSEDDESCQKIKRNYCQLE |
Concentration | SDS-PAGE,95%。,,。ChapGPT,。 |
Endotoxin_level | LAL test was used to determine the presence of less than 0.1 ng/μg (1 IEU/μg) in the given sample. The content has been rearranged to ensure that the generated information closely resembles the original text. |
Reconstitution | It is strongly advised to always centrifuge tubes before opening them. Avoid mixing through vortex or pipetting methods. Reconstituting the protein to a concentration lower than 100 μg/ml is not recommended. To dissolve the lyophilized protein, use ddH2O. Remember to aliquot the reconstituted solution to minimize freeze-thaw cycles. It is important to note that the generated content should be significantly different from the original text information. |
Target | |
Background | CD94 (Cluster of Differentiation 94), also known as killer cell lectin-like receptor subfamily D member 1 (KLRD1), is expressed on the surface of natural killer cells in the innate immune system. CD94 Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. CD94 Can form disulfide-bonded heterodimer with NKG2 family members. The CD94/NKG2 complex, on the surface of natural killer cells interacts with Human Leukocyte Antigen (HLA)-E on target cells. Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus. |
Accession | Q13241 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human natural killer cells antigen cd94/cd94 (n-6his) #abs04604, China recombinant human natural killer cells antigen cd94/cd94 (n-6his) #abs04604 suppliers
Send Inquiry
You Might Also Like






