Recombinant Human Inactive Tyrosine-protein Kinase Transmembrane Receptor ROR1/Neurotrophic Tyrosine Kinase/ROR1(C-Fc) #abs04683

abs04683-10ug

1-2 Weeks

77

abs04683-50ug

1-2 Weeks

230

abs04683-500ug

1-2 Weeks

963

abs04683-1mg

1-2 Weeks

1310

Description

The use of a Mammalian expression system results in the production of Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1. Our system efficiently expresses the target gene encoding Gln30-Glu403, which includes a Fc tag at the C-terminus. By harnessing the power of this system, we are able to provide high-quality, bioactive ROR1 for numerous research applications.

Other names

ROR1, also known as neurotrophic tyrosine kinase receptor-related 1 or receptor tyrosine kinase-like orphan receptor 1, is a transmembrane receptor protein involved in signaling pathways. This protein plays a crucial role in regulating various cellular processes. It belongs to the receptor tyrosine kinase family and possesses tyrosine-protein kinase activity.
ROR1 is an important receptor that is widely expressed in different tissues and cell types. It is particularly abundant during embryonic development and plays a pivotal role in organogenesis and tissue formation. Furthermore, ROR1 has been implicated in various diseases, including cancer and immune disorders.
The function of ROR1 is not fully understood, but it is believed to be involved in cell proliferation, differentiation, and survival. It can activate several signaling pathways, including the Wnt pathway, which is crucial for embryonic development and tissue homeostasis.
Studies have shown that ROR1 interacts with other proteins and receptors, mediating complex signaling networks. It can also modulate the activity of other growth factor receptors, such as the epidermal growth factor receptor (EGFR), contributing to cellular responses.
Understanding the role of ROR1 is essential for uncovering its potential as a therapeutic target. Researchers are actively studying its functions and developing targeted therapies to modulate its activity in diseases such as cancer, where ROR1 is often overexpressed.
In summary, ROR1 is a transmembrane receptor protein with tyrosine-protein kinase activity. It is involved in various cellular processes and plays a crucial role in embryonic development and disease pathogenesis. Further research will deepen our understanding of ROR1 and its potential as a therapeutic target.

Source

Human Cells

Format

A solution of PBS, with a pH of 7.4, was filtered through a 0.2 μm filter and then lyophilized.

Properties

aa_sequence

NWIISLSWSELPTVQTEESSKTNLIDEYPNLNTITTSMEAQLGTAHVSKPNPIRFFWDPVQDPLE RRSFPNIRLGTIDRYSSNRIILNTDFTTGCDQVAKGNTESVVLKKFGVPAPPTGSYEDDEYECQ PYRIGCAFVNRMTVYGLEMQHEIGTAQILFSTSMTILGYHVKDSCFAPLACYKFPYCPTEPDVSR LCEENICEFLIYKASNMPAIRSNPFVRLKLPQCEDELPQAECIIPSEAPGIRICIPMGAPNIKHKN YDGRVTVPTSQGQCRPNFQTWSYHPYTFTALRHENLGGSPRCNQNEGWCTFALDLLKPNCDKDSCKM ENDKGMDEEPKKSCTDCPAPLPGEPSVFLFPPPKDTLMTSRVEICVVVDSHEDPEVKFNWYVNGLE HVNARTKPRETQNYVSVSLTIHQDVWLGKKEYCCVKNASPAPIKSTIREAQKNGQPPTVYLPSREE QVTMLNCLVKGFYPSDVEAIWEESNGNKYPPTNTKSLVSDLGLFFYSVLKDTKRWQGNVFSCSVM HEALHNHYTQKSLSLSPGK.

Concentration

SDS-PAGE95%。，。，。

Endotoxin_level

The LAL test revealed that the concentration of less than 0.1 ng/μg (1 IEU/μg) was detected. Let's rearrange the content while ensuring it reflects the original information.

Reconstitution

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Target

Background

ROR1, also known as Neurotrophic tyrosine kinase, receptor-related 1, belongs to the ROR subfamily of Tyr protein kinase family,a protein kinase superfamily. It has very low kinase activity in vitro and is unlikely to function as a tyrosine kinase in vivo. Human ROR1 is a type I transmembrane protein with 937 amino acids (aa) in length. It contains a 29 aa signal sequence, a 377 aa extracellular domain (ECD), a 21 aa transmembrane segment, and a 510 aa cytoplasmic region. Human ROR1 shares 97% and 58% aa sequence identity with mouse ROR1 and human ROR2, respectively. ROR1 may act as a receptor for wnt ligand WNT5A which may result in the inhibition of WNT3A-mediated signaling. ROR1 expressed strongly in human heart, lung and kidney, but weakly in the CNS. Its Isoform Short is strongly expressed in fetal and adult CNS and in a variety of human cancers, including those originating from CNS or PNS neuroectoderm.

Accession

Q01973