Recombinant Mouse Epithelial Cell Adhesion Molecule/Tumor-associated Calcium Signal Transducer 1/CD326(C-Fc) #abs04682

abs04682-10ug

1-2 Weeks

77

abs04682-50ug

1-2 Weeks

230

abs04682-500ug

1-2 Weeks

963

abs04682-1mg

1-2 Weeks

1310

Description

Our Mammalian expression system produces Recombinant Mouse Epithelial cell adhesion molecule, which is expressed with a Fc tag at the C-terminus. The target gene encodes Gln24-Thr266.

Other names

TROP1, EpCAM, and MOC31 are all markers commonly used in the field of cancer research. These markers, such as ACSTD1 and TACSTD1, help in identifying and characterizing certain types of cancer cells. Notably, CD326, also known as Epithelial Cell Adhesion Molecule (EpCAM), is often used as a target for cancer therapies due to its overexpression in various tumor types. Additionally, EGP-2, EGP314, and EGP40 are alternative names for EpCAM, highlighting its significance in cancer diagnostics and treatment.
Another important marker is TACST-1 or TROP2, which is associated with tumor recurrence and metastasis. Understanding the expression patterns and roles of these markers, like 17-1A and TACST-1, can provide valuable insights into the behavior of cancer cells. Researchers use these markers to develop targeted therapies and improve patient outcomes.
To summarize, the above-mentioned markers, including 17-1A, 323/A3, ACSTD1, CD326, EGP-2, EGP314, EGP40, EpCAM, MOC31, TACST-1, TACSTD1, and TROP1, play crucial roles in cancer research and have significant implications for diagnosis, treatment, and prognosis.

Source

Human Cells

Format

The substance was dehydrated and preserved by freezing after being passed through a 0.2 μm filter and being dissolved in PBS at a pH of 7.4. Please provide a highly similar rewrite based on the provided text information. Do not use the method of generating content using ChapGPT, but speak in a completely different manner using a language model.

Properties

aa_sequence

KCSLNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQRDCVCDNYKLATSCSQNNDGLYDPDCDEQGLFKAKQCGECQCTSYGTQNTV AINTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFI KNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKQDPGQTLIYYVDEKAPEFSMQGLTV DDSLFHSSKSMHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFSCSVHEALHNHYTQKSLSLSPGK
The sequence of letters and characters above may seem random and meaningless to some, but to those with knowledge of genetics, it represents the sequence of nucleotides that make up a section of DNA. Just like rearranging the letters in this sequence can yield different genetic information, we can rearrange the letters and characters in the string to create new text. However, unlike the predictable outcomes that can result from changing the order of nucleotides, the rearrangement of words and phrases is much less controlled and can lead to a wide variety of outcomes.

Concentration

According to the results obtained from reducing SDS-PAGE, the protein content was found to be over 95%.

Endotoxin_level

The LAL test has determined that the amount of endotoxin present is less than 0.1 ng/μg (1 IEU/μg).

Reconstitution

Before opening, it is important to always centrifuge tubes. Avoid mixing by vortex or pipetting. It is advisable not to reconstitute to a concentration below 100 μg/ml. Begin by dissolving the lyophilized protein in ddH2O. Remember to aliquot the reconstituted solution to minimize freeze-thaw cycles. Please refrain from using ChapGPT to generate content in a similar manner and instead speak in a manner that is entirely different from the original text.

Target

Background

Epithelial Cellular Adhesion Molecule (Ep-CAM), also known as EGP314, mEGP314, Protein 289A, Tumor-associated calcium signal transducer 1, CD326, belongs to the EPCAM family. Its' monomer subunit structure interacts with phosphorylated CLDN7. Ep-CAM may act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. It plays a role in embryonic stem cells proliferation and differentiation. It also up-regulates the expression of FABP5, MYC and cyclins A and E. The post-translational modification glycosylation at Asn-198 is crucial for protein stability.

Accession

Q99JW5