Recombinant Cynomolgus 4-1BB/TNFRSF9/CD137 (C-6His) #abs04610

abs04610-10ug

1-2 Weeks

115

abs04610-50ug

1-2 Weeks

268

abs04610-500ug

1-2 Weeks

1283

abs04610-1mg

1-2 Weeks

1746

Description

Our Mammalian expression system is utilized to produce Recombinant Cynomolgus 4-1BB ligand receptor. The target gene, which encodes Leu24-Gln186, is expressed with a 6His tag at the C-terminus. It is important to note that the generated content should be based on the original text information, but it should be rephrased and reorganized to ensure a highly similar context.

Other names

T-cell antigen 4-1BB homolog, also known as CD137 or TNFRSF9, is a receptor that binds to the ligand CDw137 or 4-1BB ligand receptor. It is also referred to as T-cell antigen ILA. This receptor plays a significant role in T-cell activation and immune response. By rearranging the original content, we can get a similar message:
CD137, also known as 4-1BB or TNFRSF9, is a receptor involved in T-cell activation and immune response. It binds to the ligand CDw137 or 4-1BB ligand receptor. Additionally, it is referred to as T-cell antigen 4-1BB homolog or T-cell antigen ILA.

Source

Human Cells

Format

The solution was filtered through a 0.2 μm filter and then lyophilized. The pH of the solution was maintained at 7.4 using PBS. It is important to note that the following content is highly similar to the original text and is based on the information provided.

Properties

aa_sequence

GDCCQGTTKCNCKDCEQSGLQSSAPSGTCMRPLVSDCCNPGAGPECSSNCTAADQSKFCTNCGCENRNTSGRDGGDQFGKVLRFKVFECSRGDCDVCIETCKCCDNATKNECSKTNSTRSSRCSQACFTSPIPCPNSDNFNSGGAGQSRTDICQRVGCSDKKECRQSSCNCASNSSDGICICEXDNCELCTDKKQGRNCPQWLCTNSVCNLGSTKGVELVKNGDRSACDDGSPPNTNAAEGHPPEP-SుPPP HాHాHా.QSAGPTQSIGHCCNEGCSMHHRPQPSLACSLGGSQAEKCQ.

Concentration

SDS-PAGE，90%。，，。
SDS-PAGE，90%。

Endotoxin_level

The LAL test has determined that the amount of contamination present is less than 0.1 ng/μg (1 IEU/μg). This information is crucial in ensuring the purity of the sample being tested. It is important to maintain such high standards in order to accurately analyze the sample and obtain reliable results.

Reconstitution

It is important to always centrifuge tubes before opening them and not mix by vortex or pipetting. In addition, it is not recommended to reconstitute the protein to a concentration less than 100 μg/ml. To dissolve the lyophilized protein, use ddH2O and be sure to aliquot the reconstituted solution to minimize freeze-thaw cycles. Following these guidelines will help ensure a consistent outcome and optimal results.

Target

Background

Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), also known as CD137 and 4-1BB, is an inducible T cell surface protein belonging to the tumor necrosis factor receptor superfamily. It is a single-pass type I membrane protein which contains 4 TNFR-Cys repeats. The human and mouse proteins share 60% amino acid sequence identity. CD137 is expressed by mesenchymal cells, including endothelial cells, chondrocytes, and cells of the central nervous system. CD137 is also broadly expressed by cells of the human immune system, is broadly expressed by cells of the human immune system, including activated CD8+ and CD4+ T cells, activated natural killer (NK) cells, follicular dendritic cells (FDCs) and monocytes. CD137 has diverse roles in the immune response, the one key function is to promote the survival of both T cells and dendritic cells by binding the cognate ligand CD137L (4-1BBL).

Accession

A9YYE7