Recombinant Human Lymphocyte Function-associated Antigen 3/CD58/LFA-3 (C-Fc) #abs04611

abs04611-10ug

1-2 Weeks

138

abs04611-50ug

1-2 Weeks

382

abs04611-500ug

1-2 Weeks

1925

abs04611-1mg

1-2 Weeks

2619

Description

Our Mammalian expression system allows us to produce Recombinant Human Lymphocyte function-associated antigen 3, with the target gene coding for Phe29-Arg215 being expressed with a Fc tag at the C-terminus. The resulting product is highly similar to the original protein, ensuring its quality and efficacy.

Other names

CD58, also known as Lymphocyte Function-Associated Antigen 3 or LFA-3, is a surface glycoprotein that plays a crucial role in lymphocyte function. The CD58 antigen, also referred to as LFA3 or Ag3, is involved in cell adhesion and immune responses.
CD58 is a glycoprotein found on the surface of various cell types, including lymphocytes and antigen-presenting cells. It interacts with CD2, which is another surface glycoprotein found on T cells, natural killer cells, and some B cells. The binding between CD58 and CD2 contributes to the formation of stable cell-cell contacts, facilitating the activation and interaction of immune cells.
The primary function of CD58 is to mediate cell adhesion, particularly between T cells and antigen-presenting cells. This interaction is crucial for effective immune responses, as it allows for the recognition and activation of specific immune cells. Additionally, CD58 is involved in the regulation of T-cell activation and proliferation.
CD58 has also been implicated in various disease processes. Alterations in CD58 expression or function have been associated with autoimmune disorders, such as multiple sclerosis and rheumatoid arthritis. Furthermore, certain pathogens, including viruses and bacteria, can exploit CD58 to facilitate their entry into host cells.
In conclusion, CD58, also known as Lymphocyte Function-Associated Antigen 3 or LFA-3, is a surface glycoprotein that plays a vital role in lymphocyte function and immune responses. Its interaction with CD2 contributes to cell adhesion and immune cell activation. Understanding the function of CD58 is essential for unraveling the complexities of immune system regulation and developing targeted therapies for immune-related diseases.

Source

Human Cells

Format

The solution in question was filtered through a 0.2 μm filter and then lyophilized. The resulting product was based on a solution of PBS with a pH level of 7.4.

Properties

aa_sequence

INTGKFQKIKKLVNGGKQVVEIPLLVRSMWQSSDVQIFDENSATKRRGDFKDRYNELSGLGVY SSHRPLSLSDNTTKIMCYLQWLLFVKETENNIVMNTDGSTSLWETYVVTDNDPSGEEMEYEFSRK SMSGTMNQYPLYTFQDLKSNLYKNFNDTNYKPPIHIRYGTMELHGLDFVPVHKPPLVAWSNGRQIK GVRRYYQLDSKMFIKKKTHCETKKRSTNNALYKCEIILDSQVTVGNACRGSFVRHSNNLYYAYIRN SISMKLLPTEHNKVNCPDESSPYSYGKNFPLQTSDYMVIPKSNIGVAMSDMQGSKPEQNWTVIEDV NQCCAWAEQKLATVQPGLDSALIVQPHFNKWKGNPSDTVEYKHLSREFNQLPHASSDTDKKDSIKR WLMVIPKFNKSGREFVLPIPDLHSPWNSKMQTFQKKDTEYVYSQIDTPLKTECGVLSPKMNVKF.

Concentration

The level of similarity was found to be over 95% through SDS-PAGE analysis. To create a similar statement using different wording, it can be said that the protein sample showed more than 95% resemblance after undergoing SDS-PAGE reduction.

Endotoxin_level

The LAL test has determined that the amount of endotoxin present is less than 0.1 ng/μg, which is equivalent to 1 IEU/μg.

Reconstitution

Make sure to always centrifuge the tubes before opening them. Avoid mixing by vortex or pipetting. It is strongly advised not to reconstitute the protein to a concentration below 100 μg/ml. Use ddH2O to dissolve the lyophilized protein. Remember to aliquot the reconstituted solution to minimize the number of freeze-thaw cycles. To maintain the original text information, please rearrange the content without generating a highly similar version.

Target

Background

Lymphocyte function-associated antigen 3 (LFA-3/CD58) is a single-pass type I membrane protein. CD58 is widely expressed on hematopoietic and non-hematopoietic human tissue and has been found on leukocytes, erythrocytes, endothelial cells, epithelial cells and fibroblasts of human origin. It is a Ligand of the T-lymphocyte CD2 glycoprotein. This interaction is important in mediating thymocyte interactions with thymic epithelial cells, antigen-independent and -dependent interactions of T-lymphocytes with target cells and antigen-presenting cells and the T-lymphocyte rosetting with erythrocytes. In addition, the LFA-3/CD2 interaction may prime response by both the CD2+ and LFA-3+ cells.

Accession

P19256