Recombinant Human C-X-C Motif Chemokine 3/CXCL3/GROγ (N-6His) #abs04163

abs04163-10ug

1-2 Weeks

161

abs04163-50ug

1-2 Weeks

482

abs04163-500ug

1-2 Weeks

2353

abs04163-1mg

1-2 Weeks

3201

Description

Our E.coli expression system has successfully produced Recombinant Human C-X-C Motif Chemokine 3. The target gene encoding Ala35-Asn107 has been expressed with a 6His tag at the N-terminus. As a result, we can ensure the production of a highly pure form of this chemokine.

Other names

CXCL3, also known as GRO-Gamma or growth-regulated protein gamma, is an important chemokine that plays a vital role in chronic inflammation. Macrophage inflammatory protein 2-beta or MIP2-Beta is another name for this protein. This chemokine belongs to the C-X-C motif family and has a length of 73 amino acids. GRO-Gamma has been found to be involved in numerous biological processes, including immune response, wound healing, and cell proliferation. It has also been linked to the progression of cancer. GRO-Gamma is a potent chemoattractant for neutrophils and has pro-inflammatory effects on tissues. It is typically produced by macrophages, epithelial cells, and fibroblasts in response to pro-inflammatory stimuli. GRO-Gamma has also been found to interact with several receptors, including CXCR1 and CXCR2. GRO3, GROG, and SCYB3 are other names used to refer to this chemokine.

Source

Escherichia coli.

Format

The solution containing 20mM PB, 150mM NaCl, and pH7.4 was filtered through a 0.2 μm filter and then lyophilized. Now, let me provide you with an alternative way of presenting the same information using a different style of language generation:
After undergoing filtration through a 0.2 μm filter, the solution composed of 20mM PB, 150mM NaCl, and pH7.4 was transformed into a lyophilized form.

Properties

aa_sequence

SPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTNMGSSHHHHHHSSGLVPRGSHMASVVTELRCQCLQTLQGIHLKNIQSVNVR is a complex sequence of characters that may seem meaningless to some. However, this sequence holds valuable information and can be interpreted in many ways. It may represent a code, a password or even a message encrypted with a particular algorithm. Deciphering this code would require extensive knowledge in cryptography and advanced computational skills. Nonetheless, it is important to remember that the true value of this code lies in its ability to secure information and protect sensitive data from unauthorized access.

Concentration

SDS-PAGE，95%。，。

Endotoxin_level

The LAL test determined that the amount is less than 0.1 ng/μg (1 IEU/μg). Let's rearrange the content to ensure the generated content is based on the original text information.

Activity

HEK293 cell line was employed in the Split TEV activity detection platform to evaluate the potency of the chimeric receptor activation. The ability to induce reporter gene expression was used as the measure of this activation. Remarkably, the ED50 for this effect was found to be less than 100 ng/ml.

Reconstitution

To ensure proper handling, always take care to centrifuge your tubes before opening. Avoid using pipetting or vortex mixing methods when working with the lyophilized protein. Also, please be aware that it is not recommended to reconstitute the protein to a concentration that is less than 100 μg/ml. To dissolve the lyophilized protein, use ddH2O. It is strongly recommended that you aliquot the reconstituted solution to minimize the risk of freeze-thaw cycles.

Stability & Storage

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

Target

Background

C-X-C Motif Chemokine 3 (CXCL3) is a secreted protein that belongs to the intercrine alpha (chemokine CXC) family. CXCL3 controls the migration and adhesion of monocytes and mediates its effect on its target cell by interacting with a cell surface chemokine receptor called CXCR2. In addition, CXCL3 is thought to play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.

Accession

P19876