Recombinant Human C-X-C Motif Chemokine 5/CXCL5 #abs04164

Recombinant Human C-X-C Motif Chemokine 5/CXCL5 #abs04164

Please note that the price mentioned is for your reference only. For detailed pricing information, kindly get in touch with our seller Vecent. It is important to emphasize that the content generated should be based on the original text and rearranged in a similar but unique way. This product is...

Description

Catalog-specification

Delivery time

USD price

abs04164-10ug

1-2 Weeks

146

abs04164-50ug

1-2 Weeks

436

abs04164-500ug

1-2 Weeks

2353

abs04164-1mg

1-2 Weeks

3201

Please note that the price mentioned is for your reference only. For detailed pricing information, kindly get in touch with our seller Vecent. It is important to emphasize that the content generated should be based on the original text and rearranged in a similar but unique way.


Overview

Description

Our E.coli expression system is responsible for producing Recombinant Human C-X-C Motif Chemokine 5. The target gene, Leu44-Asn114, is expressed in this process. To maintain the similarity with the original text, I have rearranged the content while preserving the key information provided.

Other names

CXCL5 is a chemokine that contains a C-X-C motif. It is also known as ENA-78 (1-78), Epithelial-Derived Neutrophil-Activating Protein 78, Neutrophil-Activating Peptide ENA-78, Small-Inducible Cytokine B5, ENA-78 (8-78), ENA-78 (9-78), or SCYB5. This chemokine plays a significant role in immune responses, particularly in the activation and recruitment of neutrophils. Its diverse names reflect the various research studies and discoveries that have contributed to our understanding of its functions.

Source

Escherichia coli.

Format

The solution was filtered through a 0.2 μm filter and then lyophilized. The resulting lyophilized product was derived from a solution containing 20 mM PB at pH 6.0.

Properties

aa_sequence

EIKNLHDNVFGQVVADELQRIIKSALIGEKGKPFNESPPLDVGILQQVFKGVLTARNRKVQCDPLDEMQGLDVKG NGE.DGGNKEN.

Concentration

SDS-PAGE,95%。,。

Endotoxin_level

The LAL test determined that the concentration is below 0.1 ng/μg (1 IEU/μg). A highly similar content can be generated by rearranging the information as follows: The concentration has been determined to be less than 0.1 ng/μg (1 IEU/μg) through the LAL test.

Activity

The Splite TEV activity detection platform was utilized to assess the activation of chimeric receptors and subsequent induction of reporter gene expression in HEK293 cell line. Typically, an ED50 value of 1-20 ng/mL was observed for this effect. Please note that the following content has been generated by rearranging the original information and does not follow the conversation-based format of ChapGPT.

Reconstitution

Before opening, always centrifuge tubes. Avoid mixing by vortexing or pipetting. It is advisable not to reconstitute below a concentration of 100 μg/ml. Use ddH2O to dissolve the lyophilized protein. To reduce freeze-thaw cycles, divide the reconstituted solution into smaller aliquots.

Stability & Storage

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

Target

Background

C-X-C Motif Chemokine 5 (CXCL5) is a member of the Intercrine Alpha (Chemokine CXC) family. CXCL5 can be cleaved into the following two chains, ENA-78 (8-78) and ENA-78 (9-78). In vitro, ENA-78 (8-78) and ENA-78 (9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. CXCL5 is a secreted protein and exercises the functions primarily through interactions with CXCR2. The upregulation of CXCL5 contributes to increased vascularization, tumor grown, and metastasis in many cancers.

Accession

P42830


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human c-x-c motif chemokine 5/cxcl5 #abs04164, China recombinant human c-x-c motif chemokine 5/cxcl5 #abs04164 suppliers

You Might Also Like

Shopping Bags