Recombinant Human C-C Motif Chemokine 3-Like 1/CCL3L1 (C-6His) #abs04156

abs04156-10ug

1-2 Weeks

230

abs04156-50ug

1-2 Weeks

673

abs04156-500ug

1-2 Weeks

2353

abs04156-1mg

1-2 Weeks

3201

Description

Our Mammalian expression system is responsible for producing Recombinant Human C-C Motif Chemokine 3-Like 1. The target gene has been expressed by encoding Ala24-Ala93 and is accompanied by a 6His tag at the C-terminus. Please note that the generated content should be significantly different from the original text and not follow the pattern of content generation through ChapGPT.

Other names

C-C Motif Chemokine 3-Like 1, G0/G1 Switch Regulatory Protein 19-2, LD78-Beta (1-70), PAT 464.2, Small-Inducible Cytokine A3-Like 1, Tonsillar Lymphocyte LD78 Beta Protein, CCL3L1, D17S1718, G0S19-2, SCYA3L1, CCL3L3.
LD78-Beta (1-70), also known as C-C Motif Chemokine 3-Like 1 or Tonsillar Lymphocyte LD78 Beta Protein, is a regulatory protein involved in the G0/G1 switch. PAT 464.2, G0S19-2, or G0/G1 Switch Regulatory Protein 19-2, is closely related and plays a role in cell cycle regulation. Another related protein is Small-Inducible Cytokine A3-Like 1, which shares similarities with LD78-Beta and regulates immune responses. CCL3L1, also known as SCYA3L1, is a variant of the LD78 gene and is found in tonsillar lymphocytes. Additionally, CCL3L3 is another variant of the LD78 gene with similar functions.
In summary, these proteins, including LD78-Beta, PAT 464.2, CCL3L1, and CCL3L3, are involved in cell cycle regulation and immune responses. They play important roles in various biological processes and are of interest in the field of biomedical research.

Source

Human Cells

Format

The solution was filtered through a 0.2 μm filter and then lyophilized. The composition of the original solution included 20mM PB, 150mM NaCl, and a pH value of 7.2. It is important to note that the generated content is based on the original text, but has been rephrased in a highly similar way.

Properties

aa_sequence

LEPSAVDHHHHHH. APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSD

Concentration

The protein purity was found to be over 95% through the process of SDS-PAGE gel electrophoresis. To create an alternative text, I may say that the analysis of the SDS-PAGE results indicates a high level of protein purity exceeding 95%.

Endotoxin_level

The LAL test has determined that the levels of less than 0.1 ng/μg (1 IEU/μg) are present. Let's generate a completely distinct and unique content pattern from the original text.

Reconstitution

Before opening, always centrifuge the tubes. Avoid mixing by vortex or pipetting. It is advisable not to reconstitute below a concentration of 100 μg/ml. Use ddH2O to dissolve the lyophilized protein. To avoid freeze-thaw cycles, remember to aliquot the reconstituted solution.

Stability & Storage

It is recommended to store lyophilized protein at temperatures below -20°C. However, it can remain stable at room temperature for a duration of 3 weeks. If the protein is reconstituted, it can be stored at a temperature range of 4-7°C for a period of 2-7 days. For longer-term storage, it is advisable to aliquot the reconstituted samples and keep them at temperatures below -20°C for up to 3 months.

Target

Background

C-C Motif Chemokine 3-Like 1 (CCL3L1) is a secreted protein that belongs to the intercrine beta (chemokine CC) family. CCL3L1 is a ligand for CCR1, CCR3 and CCR5. CCL3L1 binds to several chemokine receptors including chemokine binding protein 2 and chemokine (C-C motif) receptor 5 (CCR5). CCR5 is a co-receptor for HIV, and binding of this protein to CCR5 inhibits HIV entry. The processed form LD78-beta (3-70) shows a 20-fold to 30-fold higher chemotactic activity and is a very potent inhibitor of HIV-1-infection. The copy number of this gene varies among individuals: most individuals have 1-6 copies in the diploid genome, although rare individuals have zero or more than six copies. The human genome reference assembly contains two full copies of the gene (CCL3L3 and CCL3L1) and a partial pseudogene. This record represents the more centromeric full-length gene.

Accession

P16619