
Recombinant Human Fc γ RIIIb/CD16b(NA1) His Tag
Tips:This product is for research use only. Not for use in diagnostic prodcedures.
Description
| SKU-Pack Size | Availability | Price |
| abs05038-50μg | 1-2 weeks | $286.00 |
| abs05038-100μg | 1-2 weeks | $476.00 |
| abs05038-500μg | 1-2 weeks | $1349.00 |
| Overview | |
| Synonym | Fc-gamma receptor III-beta, also known as FcR-10, CD16b, IgG Fc receptor III-1, FCG3, FCGR3B, and low affinity immunoglobulin gamma Fc region receptor III-B, is an important receptor that plays a crucial role in immune responses. This receptor is commonly found on the surface of certain immune cells, including natural killer cells and macrophages, and it is responsible for binding to the Fc portion of immunoglobulin G, or IgG, antibodies. Upon binding, this receptor can trigger various immune responses, such as antibody-dependent cellular cytotoxicity and phagocytosis, which are critical for protecting the body against infection and disease. Understanding the function and regulation of Fc-gamma receptor III-beta is therefore crucial for advancing our knowledge of the immune system and developing new therapies for immune-related disorders. |
| Source | human |
| Molecular Weight | 33-40 kDa(reducing state) |
| Appearance | freeze-dried powder |
| Properties | |
| Amino Acid Sequence | The protein sequence O75015, with the sequence Gly17-Ser200 and C-10*His, is GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHVGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISGGGSGGGSHHHHHHHHHH. Here's a reorganized version of the content, ensuring that it still retains the original information: The protein sequence GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHVGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISGGGSGGGSHHHHHHHHHH (O75015, Gly17-Ser200, with C-10*His). Please note that this is not generated in the same format as ChapGPT conversations. Instead, it is a reorganization of the content using a language model to provide a different representation of the original information. |
| Purity | >95% SDS-PAGE(reducing state) |
| Endotoxin Level | <0.1 EU/μg(gel method) |
| Reconstitution | The specification requires that ultra-pure water be added to the rapidly centrifuged sample until it reaches a concentration of no more than 1mg/mL. This step ensures that the desired concentration is achieved and maintained for subsequent analysis. |
| Storage Temp. | To ensure long-term storage, it is recommended to dissolve the product first. After dissolution, it can be safely stored in a refrigerator set at -20℃ to -80℃ for a period of 12 months. However, to avoid subjecting the product to repeated freeze-thaw cycles, it is advisable for customers to divide it into smaller portions and store them in a -20℃ to -80℃ refrigerator, in accordance with specific usage requirements. This method of packaging and storing the product will help maintain its quality and effectiveness over time. |
| General Notes | We have a recombinant protein that requires the addition of trehalose. If you are in need of trehalose, our product contains 5% trehalose. Please get in touch with us for further details. |
| Target | |
| Background | The Fc γ R is an Ig superfamily receptor that plays a significant role in either activating or suppressing immune responses. In humans, there are three identified Fc γ Rs, namely RI (CD64), RII (CD32), and RIII (CD16). CD16, also referred to as Fcγ RIII (A and B), is a low affinity receptor that binds to the Fc portion of the IgG antibody. This receptor is encoded by two highly homologous genes in a cell type-specific manner. Specifically, CD16b (FCGR3b or FCG3b) is expressed solely by neutrophils and stimulated eosinophils. CD16b interacts with both complex or aggregated IgG and monoclonal IgG but does not mediate antibody-dependent cytotoxicity and phagocytosis. The HEK293 cell line was used to express the recombinant protein of human Fc γ R ⅲ B /CD16b(NA1), which underwent multiple purification steps, filtration, 5% trehalose addition, and freeze-drying to obtain the final product. |
| Accession | O75015 |
Tips:This product is for research use only. Not for use in diagnostic prodcedures.
Hot Tags: recombinant human fc γ riiib/cd16b(na1) his tag, China recombinant human fc γ riiib/cd16b(na1) his tag suppliers
Send Inquiry
You Might Also Like
-

Recombinant Mouse CD28//TP44 (C-Fc-6His) #abs04037
-

Recombinant Human Fc γ RIIIa/CD16a(F176) His Tag
-

Recombinant Human LFA-3 Receptor/CD2 (C-6His) #abs04028
-

Recombinant Human GM-CSF R α/CSF2RA/CD116 (C-6His) #...
-

Recombinant Human Urokinase Plasminogen Activator Su...
-

Recombinant Human KIR2DL4/CD158d/KIR103 (C-6His) #ab...
