
Biotinylated Recombinant Human CD47 Fc Chimera
Tips:This product is for research use only. Not for use in diagnostic prodcedures.
Description
| SKU-Pack Size | Availability | Price |
| abs05028-100μg | 1-2 weeks | $349.00 |
| Overview | |
| Synonym | The monoclonal 1D8 has identified an antigenic surface determinant protein known as OA3, also referred to as the CD47 antigen, which is an integrin-associated signal transducer. This glycoprotein, CD47, is a leukocyte surface antigen that plays a crucial role in regulating various biological processes. It is also known as IAP or integrin-associated protein and MER6. The Rh-related antigen is a protein known as Protein MER6, which is associated with CD47. Together, they form an integrin associated signal transducer that influences cell signaling pathways involved in immune response and cell migration. Hence, CD47 is a significant focus in the development of new therapeutics targeting immune disorders, cancer, and vascular diseases. |
| Source | human |
| Molecular Weight | 110 kDa(Nonreducing state) |
| Appearance | freeze-dried powder |
| Properties | |
| Amino Acid Sequence | The protein sequence with C-hIgG Fc is Gln19-Pro139, which consists of the following amino acids: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK. Let's rearrange and present the information in a different format: The protein sequence Gln19-Pro139, combined with C-hIgG Fc, consists of various amino acids linked together. The sequence starts with "QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK." The protein sequence is highly complex and contains important components essential for its functionality. The arrangement of amino acids determines the structure and function of the protein. In this sequence, certain regions are critical, such as the C-hIgG Fc, which plays a significant role in antibody function. Understanding the protein sequence is crucial for studying its properties and potential applications in various fields, including medicine and biotechnology. Further analysis and research are needed to fully comprehend the structure and function of this protein sequence. |
| Purity | >95% SDS-PAGE(Nonreducing state) |
| Endotoxin Level | <0.2 EU/μg(gel method) |
| Reconstitution | The ultra-pure water was subjected to rapid centrifugation and then dissolved in a precise volume to attain a concentration of 1mg/ mL, in conformity with the specifications. Please generate a highly analogous content by rephrasing the above information while preserving the original text meaning. Avoid using ChapGPT for the generation of content and adopt a different language model for a distinctive style of speech. |
| Storage Temp. | The recommended storage conditions for the product after dissolution is in a refrigerator set at a temperature range of -20℃ to -80℃. It is advised to store the product in smaller quantities to avoid repeated freeze-thaw cycles. Customers should adhere to specific use conditions and store the product accordingly in a refrigerator with a temperature range of -20℃ to -80℃. It is important to follow these guidelines to ensure the quality and efficacy of the product throughout a storage period of 12 months. |
| General Notes | If you require the addition of trehalose recombinant protein, we have a product available that includes 5% trehalose. Please feel free to reach out to us for further information and to place an order. |
| Target | |
| Background | CD47, also known as integrin-associated protein (IAP), is a crucial "self-marker" expressed by cells. This 52 kDa glycoprotein consists of an immunoglobulin variable N-terminal domain, five transmembrane domains, and a short C-terminal intracellular tail with four variable splicing isomers, forming four isoforms. In targeted tumor immunotherapy, CD47 plays a pivotal role as it is expressed on cancer cells and interacts with SIRPα and SIRPγ from NK cells to shield cancer cells from phagocytosis and elimination. Its expression level, which is positively correlated with disease progression, is high in various solid tumor cells and malignant hematoma cells. This product is a human CD47 recombinant protein fused with recombinant human IgG1 Fc and expressed by a HEK293 cell line. The biotinylated CD47 recombinant protein is generated by coupling n-hydroxysuccinimide in biotin with free amino groups present on the recombinant protein's side chain. The recombinant protein is then freeze-dried and separately stored with 5% trehalose.![]() |
| Accession | Q08722 |
Tips:This product is for research use only. Not for use in diagnostic prodcedures.
Hot Tags: biotinylated recombinant human cd47 fc chimera, China biotinylated recombinant human cd47 fc chimera suppliers
Send Inquiry
You Might Also Like







