Recombinant Mouse TNFRSF8/CD30L Receptor/CD30 (C-6His) #abs04298

abs04298-10ug，。。，。，。

1-2 Weeks

77

50ug- abs04298
.，，。

1-2 Weeks

161

"I have a product called abs04298-500ug available. It is a potent and high-quality substance that you might find useful. Feel free to place an order if you are interested."

1-2 Weeks

917

abs04298-1mg is the identifier for a product or substance. It is important to note that the content generated should not follow the conversational style of ChapGPT, but rather provide a completely different perspective using a language model to create unique text.

1-2 Weeks

1382

Can you create a new piece of content that conveys the same message as the original text, but through a different format? I'm hoping for a completely distinct approach to the content, different from that of ChapGPT's generation.

Our team has developed a novel protein, Recombinant Mouse TNF Receptor Superfamily Member 8, utilizing our advanced Mammalian expression system. This protein is derived from the target gene encoding Phe19-Thr281 and features a 6His tag located at the C-terminus. With our cutting-edge production methods, we can ensure that this protein is highly pure and biologically active. This achievement demonstrates our commitment to advancing biological research and effectively addressing the needs of our clients.

There are many alternative terms used to refer to a person's appellation or title. Some examples include aliases, pseudonyms, handles, monikers, and screen names. These are all used to identify individuals by a name that differs from their given or legal name. Depending on the context, certain names may be more appropriate than others. For example, pseudonyms may be used in literature or online platforms, while aliases may be used by individuals seeking to remain anonymous in certain situations. Regardless of the term used, the purpose is often to provide a level of anonymity or to create a distinct identity separate from one's legal name.

The CD30 molecule, also known as lymphocyte activation antigen CD30, is a member of the tumor necrosis factor receptor superfamily. It serves as a receptor for CD30L and plays a crucial role in the activation and proliferation of lymphocytes. Aberrant expression of CD30 has been implicated in the pathogenesis of several diseases, including lymphomas and autoimmune disorders. Therefore, targeted therapy using CD30 inhibitors may hold promise for the treatment of these conditions. Additionally, CD30 and its ligand CD30L have emerged as potential targets for immunotherapy in cancer. Overall, understanding the function of CD30 and its signaling pathways may provide insights into the development of novel therapies for various diseases.

Source

Human Cells

Format

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Properties

aa_sequence

FPTDRPLKTTCAGDLSHYPGEAARNCCYQCPSGLSPTQPCPRGPAHCRKQCAPDYYVNEDGKCTA CVTCLPGLVEKAPCSGNSPRICECQPGMHCCTPAVNSCARCKLHCSGEEVVKSPGTAKKDTICEL PSSGSGPNCSNPGDRKTLTSHATPQAMPTLESPANDSARSLLPMRVTNLVQEDATELVKVPESSS SKAREPSPDPGNAEKNMTLELPSPGTLPDISTSENSKEPASTASTLSLVVDAWTSSRMQPTSPLS TGTHHHHHH

Concentration

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin_level

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Reconstitution

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Stability & Storage

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

Target

Background

CD30, also known as TNFRSF8, is a cell membrane protein of the tumor necrosis factor receptor family, which regulates proliferation/apoptosis and antibody responses. CD30 is expressed by activated, but not by resting, T and B cells. Aberrant expression of CD30 by mastocytosis mast cells and interaction with its ligand CD30L (CD153) appears to play an important role in the pathogenesis and clinical presentation of systemic mastocytosis. CD30 has been considered as a specific diagnostic biomarker of anaplastic large cell lymphoma (ALCL) and classical Hodgkin lymphoma (cHL). CD30 is also a biomarker used for targeted therapy by an antibody–drug conjugate. Soluble CD30 retains the ability to bind CD30 Ligand and functions as an inhibitor of normal CD30 signaling.

Accession

Q60846