
Recombinant Human Lymphotoxin β R/LTBR/TNFRSF3/TNFRrpv (C-6His) #abs04241
Please note that the price provided is for reference purposes only. To obtain detailed pricing information, please contact our seller Vecent. It is important to ensure that the generated content is similar to the original text by rearranging the information given. To create new content, please...
Description
Catalog-specification | Delivery time | USD price |
abs04241-10ug | 1-2 Weeks | 62 |
abs04241-50ug | 1-2 Weeks | 184 |
abs04241-500ug | 1-2 Weeks | 1177 |
abs04241-1mg | 1-2 Weeks | 1601 |
Please note that the price provided is for reference purposes only. To obtain detailed pricing information, please contact our seller Vecent. It is important to ensure that the generated content is similar to the original text by rearranging the information given. To create new content, please use a language model to generate text that differs significantly from the original text.
Overview | |
Description | Our Mammalian expression system is utilized to produce Recombinant Human Lymphotoxin beta Receptor. The target gene, which encodes Gln31-Met227, is expressed with a 6His tag positioned at the C-terminus. For generating a highly similar content, please ensure that the rearranged text remains based on the original information provided. |
Other names | The TNF receptor superfamily member 3 is also known as lymphotoxin-beta receptor, tumor necrosis factor C receptor, or tumor necrosis factor receptor 2-related protein. This receptor type III is abbreviated as TNF-RIII, TNFR-III, LTBR, D12S370, TNFCR, TNFR3, or TNFRSF3. Despite the various names, all refer to the same receptor that plays an important role in the regulation of immune system responses. TNF receptor superfamily member 3 binds to lymphotoxin-alpha and lymphotoxin-beta to activate the NF-kappaB pathway, which leads to the activation of immune responses. The receptor also binds to TNF-alpha, which is upregulated in many inflammatory diseases, to regulate immune cells. Dysregulation of TNF receptor superfamily member 3 has been implicated in various inflammatory, autoimmune, and malignant diseases. Therefore, this receptor is a promising target for the development of novel therapeutics. |
Source | Human Cells |
Format | The pH 7.4 solution containing 20mM PB and 150mM NaCl was filtered through a 0.2 μm filter before undergoing lyophilization. Let me generate a highly similar content by rearranging the given information. |
Properties | |
aa_sequence | NYTHWNEYSNCATECVTDSCDIRRSKASVYTGPPCRSCCCRIHQPYEEYKEDQDRCQTNSEPPYV QLCITGPMLVEPCDQRCLCQCQTQKRSCTEIAEELGMPVAAWCFAGTEALEKPCCGRIDSPCLEC NGNNKGDEVEPMTPLPEEPNKCTTDSTAQPGAAEVQGLQNRCRTPASHQNFHGKACPVCNHCTML MVTHHHHHHH.Let me try to rearrange the content to generate a new one: |
Concentration | As the SDS-PAGE analysis indicates, the protein purity level is above 95%. This result was obtained by carrying out appropriate procedures to reduce the sample complexity. |
Endotoxin_level | The LAL test showed that the level of endotoxins was less than 0.1 ng/μg (1 IEU/μg). A highly similar content can be generated by rephrasing the information and stating that the concentration of endotoxins was determined to be below 0.1 ng/μg (1 IEU/μg) through the use of the LAL test. |
Reconstitution | Please ensure that you always centrifuge the tubes before opening them. It is important not to mix the solution by vortex or pipetting. We strongly advise against reconstituting the protein to a concentration below 100 μg/ml. To dissolve the lyophilized protein, please use ddH2O. For optimal usage, it is recommended to divide the reconstituted solution into smaller portions to minimize the number of freeze-thaw cycles. |
Stability & Storage | To maintain the stability of lyophilized protein, it should be kept at temperatures below -20°C. However, it can be stored at room temperature for up to 3 weeks without losing its integrity. When reconstituting the protein, any leftover solution can be kept refrigerated between 4-7°C for 2-7 days. If there are any unused samples, they can be frozen at temperatures below -20°C for up to 3 months. |
Target | |
Background | Tumor necrosis factor receptor superfamily member 3, also known as Lymphotoxin-beta receptor, Tumor necrosis factor C receptor, Tumor necrosis factor receptor 2-related protein, Tumor necrosis factor receptor type III, LTBR, TNFCR, TNFR3 and TNFRSF3, is a member of the tumor necrosis factor (TNF) family of receptors. LTBR is a single-pass type I membrane protein and contains four TNFR-Cys repeats. It is expressed on the surface of most cell types, but not on T and B lymphocytes. LTBR and its ligand play a role in the development and organization of lymphoid tissue and transformed cells. Activation of LTBR can trigger apoptosis. In addition, LTBR can lead to the release of the cytokine interleukin 8. |
Accession | P36941 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human lymphotoxin β r/ltbr/tnfrsf3/tnfrrpv (c-6his) #abs04241, China recombinant human lymphotoxin β r/ltbr/tnfrsf3/tnfrrpv (c-6his) #abs04241 suppliers
Send Inquiry
You Might Also Like






