Recombinant Human TRAIL R3/TNFRSF10C/CD263 (C-6His) #abs04242

Recombinant Human TRAIL R3/TNFRSF10C/CD263 (C-6His) #abs04242

Dear customers, please note that the provided price is only for your reference. For detailed pricing information, we kindly request you to get in touch with our seller, Vecent. Rest assured, they will assist you with all the necessary details regarding pricing. This product is for research use...

Description

Catalog-specification

Delivery time

USD price

abs04242-10ug

1-2 Weeks

62

abs04242-50ug

1-2 Weeks

184

abs04242-500ug

1-2 Weeks

1177

abs04242-1mg

1-2 Weeks

1601

Dear customers, please note that the provided price is only for your reference. For detailed pricing information, we kindly request you to get in touch with our seller, Vecent. Rest assured, they will assist you with all the necessary details regarding pricing.


Overview

Description

Our Mammalian expression system is responsible for producing Recombinant Human TRAIL receptor 3. The gene encoding Ala26-Ala221 is expressed, with a 6His tag located at the C-terminus. To maintain similarity, please rearrange the provided information and ensure that the generated content is based on the original text. However, refrain from using ChapGPT-style formatting and instead deliver the content in a completely different manner.

Other names

DcR1, also known as Tumor Necrosis Factor Receptor Superfamily Member 10C or TNFRSF10C, is a decoy receptor for TRAIL/Apo-2L. It is characterized as a TRAIL receptor without a death domain or an intracellular domain. Other names for DcR1 include Lymphocyte Inhibitor of TRAIL, TNF-Related Apoptosis-Inducing Ligand Receptor 3, TRAIL Receptor 3, TRAIL-R3, CD263, TRID, and LIT. Its role as an antagonist decoy receptor makes it an important player in regulating TRAIL-induced apoptosis pathways.

Source

Human Cells

Format

pH 7.2, 150mM NaCl, and 20mM PB were combined and filtered through a 0.2 μm filter. The resulting solution was then lyophilized to obtain a dried product.

Properties

aa_sequence

GHHHHHHHHHHHTTTVAAVPEPAAGATNMTAAAETTPGSPMTTAAAETTPGSPMTTAAAETTPGT MTSAAAETTPGSPMTAAAETTSPGSMATARQEEEAQEQQTQAPEHGHSKTGEFGDNNCCPSAPV CFTESPENCACAQTVPCHSGTPHRTNCENSQCYTVDDVCRDSMKHCTKHQDQTSCSNNHSEQRCS KEGMCRPPHMAGVEQSVNNRDWTCAGYCENSVQMEPANPCNAEPEEHSTSPNENHSSSKDHKSDQ
:,。。

Concentration

The determination of greater than 95% by reducing SDS-PAGE is a reliable method to establish the protein purity.

Endotoxin_level

As determined by the LAL test, the concentration of less than 0.1 ng/μg (1 IEU/μg) is considered to be an extremely low level. Let's rearrange the information and generate a unique version of the content.

Activity

TRAIL-mediated cytotoxicity inhibition was evaluated using L-929 mouse fibroblast cells treated with TRAIL. The observed effective dose (ED50) for this inhibitory effect was found to be less than 200 ng/ml.

Reconstitution

Centrifuging tubes before opening is essential. Avoid mixing using vortex or pipetting methods. It is not advisable to reconstitute to a concentration lower than 100 μg/ml. Use ddH2O to dissolve the lyophilized protein. To prevent freeze-thaw cycles, it is recommended to aliquot the reconstituted solution. It is important to note that the following content is generated based on the original text information but presented in a significantly different manner.

Stability & Storage

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

Target

Background

Tumor Necrosis Factor Receptor Superfamily Member 10C (TNFRSF10C) is a glycosyl-phosphatidylinositol-linked membrane protein which binds TRAIL with high affinity. TNFRSF10C has the TRAIL-binding extracellular cysteine-rich domains, lacks the intracellular signaling domain. As a result, binding of TRAIL to TRAIL R3 doesn’t transduce an apoptosis signal. The expression of TRAIL R3 gene has been shown to protect cells bearing TRAIL R1 and/or TRAIL R2 from TRAIL-induced apoptosis.

Accession

O14798


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human trail r3/tnfrsf10c/cd263 (c-6his) #abs04242, China recombinant human trail r3/tnfrsf10c/cd263 (c-6his) #abs04242 suppliers

You Might Also Like

Shopping Bags