Recombinant Rabbit B7-2/CD86 (C-6His) #abs04550

abs04550-10ug

1-2 Weeks

115

abs04550-50ug

1-2 Weeks

230

abs04550-500ug

1-2 Weeks

1146

abs04550-1mg

1-2 Weeks

1528

Description

Our Mammalian expression system has successfully produced Recombinant Rabbit T-lymphocyte Activation Antigen CD86, which is composed of the target gene encoding Ala23-Arg246 with a 6His tag at the C-terminus. The resulting product is highly similar to the original protein, and carries the same functional properties as the natural antigen. Thanks to the advanced technology used in our production process, we are able to create high-quality recumbent proteins that can be used for a variety of research applications. We are committed to delivering the highest standard of quality in all our products, and our Recombinant Rabbit T-lymphocyte Activation Antigen CD86 is no exception.

Other names

The CD86 protein, also known as T-lymphocyte activation antigen CD86 or Activation B7-2 antigen, is a cell surface receptor that plays a critical role in the activation of T lymphocytes. CD86 is involved in the initiation of immune responses by stimulating the proliferation and differentiation of T cells. Its function is to bind to the CD28 molecule on T cells, leading to the activation of downstream signaling pathways that result in the activation of T cells. CD86 is a key player in the adaptive immune system and plays an important role in the regulation of immune responses. In summary, CD86 is a critical protein that plays an essential role in the activation of T lymphocytes and is essential for the functioning of the immune system.

Source

Human Cells

Format

The sample was dehydrated from a solution of PBS, pH 7.4 after being filtered through a 0.2 μm filter.

Properties

aa_sequence

EIKVARLDQEKSWNTNFSTPSKFSYALFSSNKTTTVIEYEFSGRLYVDNILELTRQRVAKRKIEYQEFWHLPNIEDVKSDLFSVYAGNRSPNTNNQKSIDGATEFGGAGYITVQTESNCSNNFPOVLVSPVAPFLKRTNLSITHQGQVERVKHMPYTDCIVPIQNYQRSLVNASTVNVDLSLESEKYDWPIPQGFLTFPNNMFRRNHEAAYGLKTTYIECQGGDVTQ

Concentration

As revealed by analysis through SDS-PAGE, the protein purity exceeds 95%. I can create a similar but unique content based on this information by stating that after undergoing SDS-PAGE analysis, it was established that the purity of the protein is greater than 95%.

Endotoxin_level

The LAL test has determined that the amount of endotoxin present is less than 0.1 ng/μg, which is equivalent to 1 IEU/μg.

Reconstitution

Prior to opening, it is imperative to centrifuge the tubes. Do not engage in any mixing through vortex or pipetting. It is highly recommended that you do not attempt to reconstitute the protein to a concentration level that is below 100 μg/ml. Start the dissolution process by using ddH2O. Whenever possible, it is suggested that you divide the reconstituted solution into smaller portions to minimize any potential damage due to freeze-thaw cycles. To ensure the highest similarity with the original text, rearrange the provided content accordingly while remaining faithful to the original information.

Target

Background

T-lymphocyte activation antigen CD86 (B7-2) is a glycosylated protein in the B7 family. B7 family members are transmembrane cell surface molecules that play important roles in immune activation and the maintenance of immune tolerance. It is highly expressed on activated antigen presenting cells. CD86 involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. It may play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. It is expressed by activated B-lymphocytes and monocytes and promoted by MARCH8 and results in endocytosis and lysosomal degradation.

Accession

P42071