
Recombinant Human UFM1-Activating Enzyme 5/UBA5 (N-6His) #abs04424
Please note that the price provided above is only for your reference. For detailed pricing information, we kindly request you to get in touch with our seller, Vecent. Feel free to reach out and they will provide you with the accurate pricing details. This product is for research use only, not...
Description
Catalog-specification | Delivery time | USD price |
abs04424-10ug | 1-2 Weeks | 161 |
abs04424-50ug | 1-2 Weeks | 482 |
abs04424-500ug | 1-2 Weeks | 2353 |
abs04424-1mg | 1-2 Weeks | 3201 |
Please note that the price provided above is only for your reference. For detailed pricing information, we kindly request you to get in touch with our seller, Vecent. Feel free to reach out and they will provide you with the accurate pricing details.
Overview | |
Description | Our E.coli expression system is responsible for producing Recombinant Human Ubiquitin-fold Modifier 1 Activating Enzyme. The target gene, which encodes Met1-Met404, is expressed with a 6His tag at the N-terminus. Please generate a substantially different content by rearranging the information mentioned above, while still being faithful to the original text. |
Other names | ThiFP1, UFM1-activating enzyme, Ubiquitin-like modifier-activating enzyme 5, UBA5, Ubiquitin-activating enzyme E1 domain-containing protein 1, UBE1DC1. These are proteins involved in various cellular processes through enzymatic activities. Ubiquitin-like modifier-activating enzyme 5, also known as UBA5, plays a key role in activating ubiquitin-like modifiers by binding to them and forming a high-energy thioester bond. This process activates the modifiers, allowing them to attach to target proteins and regulate their function. ThiFP1, on the other hand, is involved in the activation of UFM1, another ubiquitin-like modifier. By forming a thioester bond with UFM1, ThiFP1 enables its transfer to target proteins, leading to the modification of their activity or stability. UFM1-activating enzyme is responsible for the final step in UFM1 activation, where it transfers activated UFM1 to its target proteins. Lastly, Ubiquitin-activating enzyme E1 domain-containing protein 1 (UBE1DC1) is a protein that contains a ubiquitin-activating enzyme (E1) domain. This domain allows UBE1DC1 to activate ubiquitin and transfer it to downstream components of the ubiquitin-proteasome system. Collectively, these proteins play important roles in cellular processes such as protein degradation, cellular signaling, and immune response regulation. |
Source | Escherichia coli. |
Format | This solution is provided at a pH of 8.0 with 20mM TrisHCl, 1mM DTT, 10% glycerol, and 50mM NaCl, all filtered through a 0.2 μm filter. The resulting content will be highly similar to the original information, but arranged in a slightly different order. |
Properties | |
aa_sequence | VKQMHLMGRGNNKKLLLFFFFFGGGGGGSSSSSS EEEEEERRRRVVVVIIIIIIQ DMMMMMSSQQVVVYAAAIINNRRRR KEADDDIILLLLLLPTTRRSSSLLLVVV AAEEEGGGGIIIMNNNQRRRR DDEEEEGGGHHHILLLLMMMSSSTTT VAAAAAAAAINNRSSSSLVVVV QHHWVJJJJKEEEMMRRRRTSSNDDGIII. PQQAACDDDDDRKRKKVVEENNNNNTTVV AAAAKKKKLLLRRRRRMMMMVPPPQQQQTTTVZZYY EEEEGGGIKMMNQRSSTTTVNNSS RCICCRKQQQEEEGHHHIKKKLLLPPP QQSSSEEEVN |
Concentration | The determination of greater than 95% was achieved by reducing SDS-PAGE. To create a similar content, the information from the original text can be rearranged in a different order. Specifically, SDS-PAGE was used to determine the level of purity, which was found to be greater than 95%. |
Endotoxin_level | The LAL test has determined that the amount of endotoxin present is less than 0.1 ng/μg or 1 IU/μg. This information suggests that the tested sample has a low level of endotoxin contamination. |
Target | |
Background | UBA5 is a member of the ubiquitin-activating E1 family and UBA5 subfamily. Ubiquitin and ubiquitin-like proteins are recognized as covalently conjugated to various cellular substrates by a three-step enzymatic pathway. The ubiquitin-activating enzyme (E1) has a vital role in the first step of ubiquitination pathway to activate ubiquitin or ubiquitin-like proteins. UBA5 activates ubiquitin-fold modifier 1, a ubiquitin-like post-translational modifier protein, via the formation of a high-energy thioester bond. UBA5 is located primarily in cytoplasm, while it generally localizes to the nucleus in presence of SUMO2. |
Accession | Q9GZZ9 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human ufm1-activating enzyme 5/uba5 (n-6his) #abs04424, China recombinant human ufm1-activating enzyme 5/uba5 (n-6his) #abs04424 suppliers
Send Inquiry
You Might Also Like






