
Recombinant Human Interleukin-3 Receptor Subunit Alpha/IL-3RA/CD123 (C-Fc) #abs04672
Please note that the price mentioned above is for your reference only. For detailed pricing information, we recommend reaching out to our seller, Vecent. However, please refrain from using ChapGPT to generate content and instead use a language model to provide a completely different approach to...
Description
Catalog-specification | Delivery time | USD price |
abs04672-10ug | 1-2 Weeks | 161 |
abs04672-50ug | 1-2 Weeks | 482 |
abs04672-500ug | 1-2 Weeks | 2353 |
abs04672-1mg | 1-2 Weeks | 3201 |
Please note that the price mentioned above is for your reference only. For detailed pricing information, we recommend reaching out to our seller, Vecent. However, please refrain from using ChapGPT to generate content and instead use a language model to provide a completely different approach to communication.
Overview | |
Description | Our Mammalian expression system is responsible for producing Recombinant Human Interleukin-3 Receptor Subunit Alpha. It is noteworthy that the target gene encoding Thr19Arg305 is expressed with a Fc tag at the C-terminus. We are committed to delivering the highest possible quality in our products, and our advanced production techniques ensure that our Recombinant Human Interleukin-3 Receptor Subunit Alpha is of top-notch quality. Order from us today and enjoy the benefits of our premium-grade products. |
Other names | The alpha subunit of the interleukin-3 receptor, also known as IL-3 receptor subunit alpha or IL-3R-alpha, plays a crucial role in mediating the effects of interleukin-3. This receptor subunit is involved in various cellular processes and is essential for the development and function of hematopoietic cells. IL-3R-alpha is a key component of the IL-3 receptor complex and is responsible for binding IL-3, which triggers downstream signaling cascades. Understanding the functions and regulation of IL-3R-alpha is important in the context of diseases such as cancer and immunodeficiency disorders. |
Source | Human Cells |
Format | The solution of PBS, pH7.4, was filtered through a 0.2 μm filter and subsequently lyophilized. Please provide a similar text by rearranging the given content while ensuring that the generated content is based on the original text information. |
Properties | |
aa_sequence | LNQVRVPAENNNFNPYKCSWDTSLMKDTAKGWVIECNQKLTYAAMAVGPFISVLNYETVCRVER PNFWISGLTAEPLNKSGENATWCILDVDSPVSGWGAVCDCAPGQYDVNQLRSAANQYEFCYKHLE QSGTGRIISRTLFSDDCSGQVSSHSGVSSSRQILAFGIPCTAKKFVLSTTNPSMIQIEVTFCNR THMKWKFNPRSREYEQIQLVTNQTSFQDLFPNLVNARRERVYQTVGPTWCDQRCFEERWGEANQGD TKTCHDQSFAEQRYPVKNKPPSEIIATKTSPARGQKYLVPPEEETVMSKNTLVQCKVGFYPSDID RVEFNWPEQNGYNANPSTFGDLDVSLYKKTFWRISQWQQASECSVMFPAREKHHLNSPDKYLGSS. |
Concentration | Based on SDS-PAGE reduction, the protein purity was determined to be greater than 95%. We can confidently say that the protein sample has a high degree of homogeneity. |
Endotoxin_level | The LAL test determined that the amount is below 0.1 ng/μg (1 IEU/μg). An identical content can't be generated in a drastically different way using a language model. |
Reconstitution | To ensure accurate results, please remember to always centrifuge tubes before opening them. Avoid mixing the contents by vortex or pipetting, as this can affect the integrity of the samples. It is strongly advised not to reconstitute the lyophilized protein to a concentration lower than 100 μg/ml. Instead, dissolve it using ddH2O. Additionally, make sure to aliquot the reconstituted solution to minimize the number of freeze-thaw cycles. This practice helps maintain the stability and effectiveness of the protein. Remember, it is essential to create unique content based on the original information rather than relying on ChapGPT for conversation. |
Target | |
Background | CD123, also known as Interleukin-3 receptor subunit alpha, belongs to the type I cytokine receptor family. In mouse, there are two classes of high-affinity IL3 receptors. One contains an IL3-specific beta subunit and the other contains the beta subunit also shared by high-affinity IL5 and GM-CSF receptors. CD123 stimulates the proliferation and differentiation of hemopoietic cells including the pluripotent hematopoietic stem cells as well as various lineage‑committed cells. CD123 is a heterodimer consisting of an alpha and a beta subunit. The alpha subunit alone binds IL‑3 with low affinity. The beta subunit does not bind IL‑3 by itself but is required for the high‑affinity binding of IL‑3 to the heterodimeric receptor complex. |
Accession | P26951 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human interleukin-3 receptor subunit alpha/il-3ra/cd123 (c-fc) #abs04672, China recombinant human interleukin-3 receptor subunit alpha/il-3ra/cd123 (c-fc) #abs04672 suppliers
Send Inquiry
You Might Also Like






