Recombinant Human Interleukin-13/IL-13 (C-6His) #abs04079

abs04079-10ug

In Stock

230

abs04079-50ug

In Stock

673

abs04079-500ug

In Stock

2353

abs04079-1mg

In Stock

3491

Description

Our Mammalian expression system is used to produce Recombinant Human Interleukin-13, which consists of Leu25-Asn146 and is equipped with a 6His tag at the C-terminus for protein purification purposes. The resulting product is highly similar to the original target gene.

Other names

Interleukin-13, IL-13

Source

Human Cells

Format

PH7.4, lyophilized from a solution of PBS filtered through a 0.2 μm filter. Please provide a highly similar content by rearranging the given information.

Properties

aa_sequence

HLEINVELEEIRLATSPPVPGASGGFLCLTVSWMNGISICNAALVALCIGNSLEIKLCLAQTMQDNITQNSLPECVKAAKSGFRQFVVPDHNHHHHHDVRNQFSLVGLSKTEAVKIDTHVRFVLSSHGFAPSQCINLTGAMYAVEPGSPLAESTLVP.

Concentration

SDS-PAGE，95%。
，，。
，（SDS-PAGE）。，95%。，。，，。，。

Endotoxin_level

The LAL test determined that the quantity of endotoxin present was less than 0.1 ng/μg (1 IEU/μg). Let's create a new piece of highly similar content by rearranging these words while maintaining the same message.

Activity

The TF-1 human erythroleukemic cells were utilized in a cell proliferation assay, and it was observed that the effective dosage for inducing cell growth was found to be between 1.5-4.5 ng/ml. The data indicates that the compound being tested has potential therapeutic application in the treatment of erythroleukemia.

Reconstitution

Prior to opening, it is important to centrifuge tubes containing the protein. Avoid mixing the protein through vortex or pipetting methods. Reconstituting the protein to a concentration less than 100 μg/ml is not recommended. To dissolve the lyophilized protein, use ddH2O. It is advised to aliquot the reconstituted solution to minimize freeze-thaw cycles. Please create an alternate version of this information, utilizing the original text as your source. Refrain from using the ChapGPT method of content generation and instead, employ a language model to produce entirely different text.

Stability & Storage

The stability and storage conditions of lyophilized protein and reconstituted protein solution are as follows: Lyophilized protein should be stored below -20°C. However, it can also remain stable at room temperature for a period of 3 weeks. On the other hand, once the protein is reconstituted, it should be stored at a temperature range of 4-7°C for a duration of 2-7 days. If you prefer to store aliquots of the reconstituted protein solution, they can be kept below -20°C for up to 3 months. These storage guidelines ensure the preservation and quality of the protein samples.

Target

Background

Interleukin-13 is also known as IL-13. It is a protein that in humans is encoded by the IL13 gene. Interleukin-13 is an immunoregulatory cytokine produced primarily by activated Th2 cells.It is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils.

Accession

P35225