
Recombinant Human IL-21 Receptor/IL-21R (C-6His) #abs04078
Please note that the price mentioned here is only for your reference. For the actual price, we suggest you get in touch with our seller Vecent. We would like to advise you that the details of the pricing may vary based on the product or service you are looking for. So please contact our reliable...
Description
Catalog-specification | Delivery time | USD price |
abs04078-10ug | 1-2 Weeks | 69 |
abs04078-50ug | 1-2 Weeks | 161 |
abs04078-500ug | 1-2 Weeks | 993 |
abs04078-1mg | 1-2 Weeks | 1237 |
Please note that the price mentioned here is only for your reference. For the actual price, we suggest you get in touch with our seller Vecent. We would like to advise you that the details of the pricing may vary based on the product or service you are looking for. So please contact our reliable sales representative Vecent to get an accurate quote.
Overview | |
Description | Our Mammalian expression system is utilized to produce Recombinant Human Interleukin-21 Receptor. The target gene that encodes Cys20-Pro236 is expressed with a 6His tag at its C-terminus. To generate similar content, we can rearrange the original text information while retaining its meaning. |
Other names | The receptor known as interleukin-21 receptor can also be referred to as IL-21 receptor, IL-21R, or CD360. All these names refer to the same receptor and are used interchangeably in scientific literature. The receptor is a protein that binds to the cytokine interleukin-21 (IL-21), which plays a crucial role in regulating the immune response. The IL-21 receptor is expressed on the surface of various immune cells and is involved in cell signaling pathways that activate these cells. Dysregulation of the IL-21 signaling pathway has been implicated in the development of various diseases, including autoimmune disorders and cancer. Understanding the function of the IL-21 receptor and its interaction with IL-21 is, therefore, of great interest to researchers in the field of immunology. |
Source | Human Cells |
Format | pH 7.4, 150mM NaCl, and 20mM PB were combined, followed by filtration through a 0.2 μm filter. The resulting solution was then lyophilized to obtain a dry form. |
Properties | |
aa_sequence | VCFSTWTLLTPLHQNALIMEIWYDLQLTYSLTDQEEKSHTCDSAHRHSLTTNYCMAHTCTYDVIVHFMDDSFVNIQSGYSCECFLLASKIPPNFVTTSYGQNSIWRDAYDPEFYLMLGKLYEQYRQPNRGDWAVISPRRKLSVLDSRSPLEVFRRSYQELQQGKPGPMPSYYTWEWSDQIVFQTSEEELKVGNWPVDHHHHHH, the above content can be rearranged to generate a highly similar content. |
Concentration | SDS-PAGE,95%。,。 |
Endotoxin_level | The LAL test determined that the concentration is lower than 0.1 ng/μg (equivalent to 1 IEU/μg). Please provide an alternative way of expressing this information while maintaining the essence of the original text. |
Reconstitution | To ensure proper handling of lyophilized protein, it is essential to always centrifuge tubes before opening and avoid mixing by vortex or pipetting. Reconstituting the protein to a concentration less than 100 μg/ml is not advised. Instead, dissolve the lyophilized protein in ddH2O and aliquot the reconstituted solution to minimize freeze-thaw cycles. It is important to note that generating highly similar content by rearranging the above information can lead to redundancy, so it is recommended to use language models to generate new and unique content. |
Stability & Storage | To ensure optimal storage conditions for lyophilized protein, it is recommended to keep it below -20°C. However, it can also be stored at room temperature for up to 3 weeks without compromising its stability. If reconstituted, the protein solution should be stored at a temperature between 4-7°C and can be used for up to 7 days. To store for longer periods, aliquots of the reconstituted samples can be safely kept below -20°C for up to 3 months. These guidelines will help maintain the integrity and effectiveness of the protein in your research. |
Target | |
Background | Interleukin-21 receptor is also known as IL-21 receptor, IL-21R, CD360. In humans, it is encoded by the IL21R gene. It belongs to the type I cytokine receptor family. Type 4 subfamily contains 2 fibronectin type-III domains. Interleukin-21 receptor is selectively expressed in lymphoid tissues and highly expressed in thymus and spleen. IL-21 is produced by CD4+ T cells in response to antigenic stimulation. Its action enhances antigen-specific responses of immune cells. The biological effects of IL-21 include induction of differentiation of T-cells-stimulated B-cells into plasma cells and memory B-cells. It also promotes the anti-tumor activity of CD8+ T-cells and NK cells. |
Accession | Q9HBE5 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human il-21 receptor/il-21r (c-6his) #abs04078, China recombinant human il-21 receptor/il-21r (c-6his) #abs04078 suppliers
Send Inquiry
You Might Also Like






