Recombinant Mouse Transforming Growth Factor β-1/TGFβ1/TGFB1 #abs04222

abs04222-10ug

In Stock

230

abs04222-50ug

In Stock

673

Description

Our Mammalian expression system is used to produce Recombinant Mouse Transforming Growth Factor beta 1 and the target gene, which encodes Ala279-Ser390, is expressed. To create similar content, the original text information can be rearranged to state that the highly specific target gene for this product is successfully expressed using our state-of-the-art Mammalian expression system to produce Recombinant Mouse Transforming Growth Factor beta 1.

Other names

TGF-beta-1, also known as CED or DPD1, is a protein encoded by the TGFB1 gene. It is also referred to as TGFB or TGFB1 protein. CEDLAP, which stands for latency-associated peptide, is another name for this protein. TGF-beta-1 is a crucial factor in cell growth and development. It plays a significant role in modulating immune responses, inflammation, and tissue repair processes. With its diverse functions, TGF-beta-1 acts as a key regulator in various physiological and pathological processes. Its dysregulation has been linked to several diseases, including cancer and fibrosis. To fully understand its mechanisms of action and potential therapeutic interventions, ongoing research in the field of TGF-beta-1 is essential.

Source

Human Cells

Format

The solution containing 4mM HCl was filtered through a 0.2 μm filter and subsequently lyophilized. Can you create a similar content using the given information while maintaining its essence? Please note, do not use the same approach as ChapGPT for generating the content. Instead, generate the text in a completely different way using language models.

Properties

aa_sequence

KCPYYSLRQKDNWLGGPGCHCDQHQMYLSYDEKTNQVVVYFAPDICGKLFGWEKNIHKSSIAANY TCLYCIQDPAPYLGKWDLISFTGVDYAKYWSNPHYVTNYHTFDSQPVAPGSLKYVIRLCKRSAMV

Concentration

Our analysis using SDS-PAGE has shown that the protein purity is above 95%. We can confidently say that the protein has been effectively purified using this approach.

Endotoxin_level

The LAL test has determined the concentration of less than 0.1 ng/μg (1 IEU/μg). This indicates that the sample has a minimal endotoxin level, which is a desirable quality for pharmaceutical products.

Activity

TF-1 human erythroleukemic cell proliferation inhibition is a reliable measure of IL-4 inhibitory activity. The typical effective dose (ED50) for this inhibition is 0.0845ng/mL. I urge you to rearrange the content while preserving the essence of the original information, rather than using ChapGPT or any similar methods to generate content.

Reconstitution

To ensure optimal results, it is important to always centrifuge tubes before opening and avoid mixing by vortex or pipetting. To maintain the protein's integrity, it is recommended not to reconstitute to a concentration less than 100 μg/ml. To dissolve the lyophilized protein, use 4mM Hcl. It is also advisable to aliquot the reconstituted solution to minimize freeze-thaw cycles. Please note that generating highly similar content by rearranging the above content may not be the most effective way to convey information as each statement may contain different nuances that may impact the overall message.

Stability & Storage

The stability and storage conditions for lyophilized protein must be carefully considered. It is recommended to store the lyophilized protein at temperatures below -20°C to maintain its integrity and functionality. Although, if necessary, the protein can be temporarily stored at room temperature for a period of up to 3 weeks without significant degradation.
Once the lyophilized protein is reconstituted into a solution, different storage conditions apply. The reconstituted protein solution should be kept at a temperature range of 4-7°C to ensure its stability for a period of 2-7 days. This allows for short-term storage while maintaining the protein's activity.
For longer-term storage of the reconstituted protein solution, it is best to aliquot it and store the aliquots at temperatures below -20°C. This ensures the preservation of the protein's integrity for up to 3 months. By dividing the solution into smaller portions, it becomes easier to thaw and use only the required amount, minimizing the risk of repeated freeze-thaw cycles that can lead to protein degradation.
In summary, lyophilized protein should ideally be stored below -20°C, although it can tolerate room temperature for a limited duration. Reconstituted protein solutions have a shorter stability period and should be refrigerated at 4-7°C. However, for long-term storage, it is advisable to store aliquots of the reconstituted samples at temperatures below -20°C to maintain their integrity for up to 3 months.

Target

Background

TGFβ1 is a crucial factor in the peptide growth factor superfamily and plays a significant role in various cellular processes like cell-cycle progression, differentiation, motility, adhesion, bone morphogenesis, wound healing, and immune surveillance. It is also involved in critical functions like reproductive function, neuronal growth, and development. Three types of TGF-β, TGF-β1, TGF-β2, and TGF-β3, signal through the same receptor complex containing the TGF-β receptor type II and TGF-β receptor type I. SMADs mediate signal transduction from the receptor to the nucleus. TGF-β is expressed primarily in the nervous system, skin, cartilage, bone, teeth, muscle, heart, blood vessels, haematopoitic cells, lung, kidney, gut, liver, eye, and ear.

Accession

P04202