
Recombinant Human VEGF-D/FIGF (C-6His) #abs04195
Please note that the price mentioned here is for your reference only. To obtain detailed pricing information, please kindly get in touch with our sales representative, Vecent. Just a heads up, our sales team would be able to provide you with more specific details regarding the costs of our...
Description
Catalog-specification | Delivery time | USD price |
abs04195-10ug | 1-2 Weeks | 161 |
abs04195-50ug | 1-2 Weeks | 482 |
abs04195-500ug | 1-2 Weeks | 2353 |
abs04195-1mg | 1-2 Weeks | 3201 |
Please note that the price mentioned here is for your reference only. To obtain detailed pricing information, please kindly get in touch with our sales representative, Vecent. Just a heads up, our sales team would be able to provide you with more specific details regarding the costs of our products. So, if you are interested, please do not hesitate to reach out to us.
Overview | |
Description | Our Mammalian expression system is responsible for producing Recombinant Human Vascular Endothelial Growth Factor D. The target gene encoding Phe93-Ser201 is expressed with a 6His tag at the C-terminus. We take pride in delivering highly similar content that is based on the original text information. |
Other names | VEGF-D, also known as c-Fos-Induced Growth Factor (FIGF) or VEGFD, is a significant protein involved in vascular endothelial growth. This particular growth factor plays a crucial role in promoting the growth and development of blood vessels. By rearranging the provided information, we can create a highly similar content that emphasizes the importance and function of VEGF-D. |
Source | Human Cells |
Format | The sample was dried via lyophilization after being filtered through a 0.2 μm pore size filter from a solution composed of 20mM phosphate buffer, 150mM sodium chloride, and adjusted to pH 7.4. |
Properties | |
aa_sequence | TLVEKVETLKFQTDCECPTRSNFTVKNTVSCREENSEENEGKLTFFIKPSFVVNPRFCVCCGGELCMTNSVDWYPSQSEHTSISLTQELTVKELVAPVNVLIACHHPKKRCYHHE.You can generate highly similar content by rearranging the provided text as follows: |
Concentration | SDS-PAGE95%。,。 |
Endotoxin_level | The LAL test revealed a level of less than 0.1 ng/μg (1 IEU/μg) for our sample. We strive to maintain such a low level of contamination in our products. |
Reconstitution | Please adhere to the following guidelines when working with the lyophilized protein. Prior to opening the tubes, be sure to centrifuge them. Avoid incorporating air bubbles by refraining from using vortex mixers or pipetting. It is important to maintain a concentration of at least 100 μg/ml when reconstituting the protein. Begin the reconstitution process by dissolving the lyophilized protein in ddH2O. Additionally, it is recommended to aliquot the reconstituted solution in order to minimize the number of freeze-thaw cycles. It is crucial to note that the generated content should not be in the form of a conversation with ChapGPT, but rather a speech that deviates significantly from the original text. |
Stability & Storage | It is recommended to store lyophilized protein at temperatures below -20°C to ensure its stability. However, the protein can remain preserved at room temperature for up to 3 weeks. When reconstituted, the protein solution should be kept at 4-7°C for 2-7 days. To maintain the protein's integrity, it is advisable to store aliquots of the solution at temperatures below -20°C for up to 3 months. |
Target | |
Background | VEGF-D, also known as vascular endothelial growth factor D, belongs to the PDGF/VEGF family. It exhibits high expression in various organs including the lung, heart, small intestine, and fetal lung. Comparatively lower levels are observed in skeletal muscle, colon, and pancreas. The main role of VEGF-D is to promote angiogenesis, lymphangiogenesis, and the growth of endothelial cells. It stimulates their proliferation and movement, while also influencing the permeability of blood vessels. During embryogenesis, VEGF-D is involved in the development of venous and lymphatic vascular systems. Additionally, it plays a crucial role in maintaining the differentiated lymphatic endothelium in adults. VEGF-D undergoes a complex proteolytic maturation process, resulting in the formation of multiple processed forms. These forms have the ability to bind and activate receptors called VEGFR-2 and VEGFR-3. |
Accession | O43915 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human vegf-d/figf (c-6his) #abs04195, China recombinant human vegf-d/figf (c-6his) #abs04195 suppliers
Send Inquiry
You Might Also Like






