Recombinant Human VEGF-A/VEGF121 (C-6His) #abs04197

abs04197-10ug

1-2 Weeks

230

abs04197-50ug

1-2 Weeks

673

abs04197-500ug

1-2 Weeks

2353

abs04197-1mg

1-2 Weeks

3491

Description

Our Mammalian expression system produces Recombinant Human Vascular Endothelial Growth Factor A, which includes the target gene encoding Ala27-Arg147. In this expression system, the protein is expressed with a 6His tag at the C-terminus.

Other names

A (VEGF-A)， (VPF)，VEGFA，VEGF。，。

Source

Human Cells

Format

pH 7.2, lyophilized from a 0.2 μm filtered solution containing 20mM PB and 150mM NaCl, has been prepared. The composition of the solution was maintained in the generated content while rearranging the information provided.

Properties

aa_sequence

EVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEG LECPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRRVDHHHHHH APMAEGGQNH

Concentration

The level of purity was found to be over 95% using SDS-PAGE analysis. To create a similar content, the information from the original text can be rearranged and presented as follows: SDS-PAGE analysis confirmed that the purity of the sample exceeded 95%.

Endotoxin_level

The LAL test has determined that the concentration is below 0.1 ng/μg (1 IEU/μg). To restate the information, the test results show that the content is less than 0.1 ng/μg (1 IEU/μg) as determined by the LAL test.

Reconstitution

It is crucial to always centrifuge tubes before opening to ensure proper mixing. Avoid mixing by vortex or pipetting, as this could compromise the integrity of the protein. Reconstituting to a concentration less than 100 μg/ml is not recommended, as it could affect the protein's stability and function. To dissolve the lyophilized protein, use ddH2O. It's vital to aliquot the reconstituted solution to reduce freeze-thaw cycles, which could negatively impact the protein's effectiveness. Remember, the key is to generate similar content while using different wording to convey the original text's meaning.

Stability & Storage

The recommended storage conditions for lyophilized protein is below -20°C. However, it can be kept at room temperature for up to 3 weeks without significant degradation. On the other hand, reconstituted protein solution should be stored at a slightly higher temperature range of 4-7°C for a shorter period of time, typically 2-7 days. If you wish to extend the storage duration, aliquots of the reconstituted samples can be frozen at temperatures below -20°C for up to 3 months while maintaining their stability. Remember to follow these guidelines to ensure the integrity and quality of the protein during storage.

Target

Background

VEGF121, also known as Vascular endothelial growth factor A, is a glycoprotein that belongs to the PDGF/VEGF family. It is a homodimeric, heparin-binding protein that specifically acts on endothelial cells and has various effects on angiogenesis, vasculogenesis, permeabilization of blood vessels, and endothelial cell growth. VEGF121 is a glycosylated mitogen that induces increased vascular permeability, promotes cell migration, and inhibits apoptosis. Its alternatively spliced transcript variants encode either secreted or cell-associated isoforms. Upregulation of VEGF121 may promote lymphangiogenesis, which may induce VEGF-C. VEGF121 binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate, and heparin, while NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis, and inhibits tumor growth.

Accession

P15692