Recombinant Human Teratocarcinoma-Derived Growth Factor 1/TDGF1/Cripto (C-Fc) #abs04198

abs04198-10ug

1-2 Weeks

230

abs04198-50ug

1-2 Weeks

673

abs04198-500ug

1-2 Weeks

2353

abs04198-1mg

1-2 Weeks

3491

Description

Our Mammalian expression system produces Recombinant Human Teratocarcinoma-derived growth factor 1. The target gene, which encodes Leu31-Ser169, is expressed with a Fc tag at the C-terminus. To generate highly similar content, I will rearrange the above information while maintaining the original text's meaning.

Other names

CRIPTO, also known as Teratocarcinoma-derived growth factor 1 or TDGF1, with alternative names Cripto-1 growth factor and CRGF, is an Epidermal growth factor-like protein that plays a significant role in cell proliferation, differentiation, and embryonic development. This protein is involved in several cellular signaling pathways that include the transforming growth factor-beta (TGF-β) and the Wnt pathways, both of which are crucial for embryo development and homeostasis.
CRIPTO is a multifunctional protein that exhibits a diverse range of functions, with its overexpression or absence resulting in several developmental abnormalities. While it plays a crucial role in embryonic development, it also promotes cancer cell growth and metastasis in adulthood. It promotes the proliferation and survival of cancer cells by activating signaling pathways that encourage cell growth and block cancer cell apoptosis. As such, it has become a popular target for developing cancer therapies.
In conclusion, CRIPTO is a critical growth factor with diverse functions in embryonic and adult development. Its role in promoting cancer cell growth and metastasis has made it a target of interest for developing cancer therapies. Therefore, understanding the precise mechanisms of CRIPTO action and regulation can help develop an effective therapeutic approach for treating cancer.

Source

Human Cells

Format

The dried substance was obtained from a solution of PBS with a pH of 7.4, which had been filtered through a 0.2 μm filter.

Properties

aa_sequence

ACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVA LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFC SRTPELPPSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.
The above content contains a sequence of unique letters. The letters form a series of codes that can be rearranged to generate new information. This can be done by moving the letters around and forming new words or phrases. The content can be used to create endless possibilities of new content. By using your creativity and imagination, you can generate new content based on the original information. This is a great way to create fresh, unique content that is highly relevant and engaging to your audience. So, go ahead and give it a try!

Concentration

Based on the information obtained through reducing SDS-PAGE, it has been determined that the concentration exceeds 95%. In order to maintain the original text information, please generate a highly related content by rephrasing the given content.

Endotoxin_level

The LAL test indicates that the level of contaminants is below 0.1 ng/μg (1 IEU/μg). To rephrase this information while maintaining its essence, we can say that the LAL test has determined the presence of contaminants to be less than 0.1 ng/μg (1 IEU/μg).

Reconstitution

For optimal results, always remember to centrifuge your tubes before opening to ensure proper mixing. Avoid using vortex or pipetting methods as they may compromise the integrity of the protein. To achieve the best concentration, it is not advisable to reconstitute the protein at a concentration below 100 μg/ml. Simply dissolve the lyophilized protein in ddH2O and be sure to split it into smaller aliquots to minimize the risk of freeze-thaw damage. By following these guidelines, you can consistently achieve highly similar results with your protein samples.

Stability & Storage

To maintain stability, lyophilized protein should be kept at temperatures below -20°C. However, it can be stored at room temperature for up to three weeks without significant degradation. After reconstitution, protein solutions should be refrigerated at 4-7°C and can be stored for 2-7 days. If aliquots are prepared from the reconstituted sample, they can be kept at temperatures below -20°C for up to three months without significant loss of activity.

Target

Background

Teratocarcinoma-derived growth factor 1(TDGF1) is a Cell membrane protein and contains 1 EGF-like domain. The protein plays an essential role in embryonic development and tumor growth. Mutations in this gene are associated with forebrain defects. It also may play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm.

Accession

P13385