Recombinant Human C-C Motif Chemokine 5/CCL5/RANTES #abs04141

abs04141-10ug

1-2 Weeks

179

abs04141-50ug

1-2 Weeks

535

abs04141-500ug

1-2 Weeks

2353

abs04141-1mg

1-2 Weeks

3201

Description

Our E.coli expression system is responsible for producing Recombinant Human C-C Motif Chemokine 5. The target gene that is expressed encodes Ser24-Ser91. I kindly request you to generate a completely different content without following the approach of ChapGPT and instead, deliver a speech by using a language model that produces text in a completely unique manner.

Other names

SIS-Delta, also known as Small-Inducible Cytokine A5 or C-C Motif Chemokine 5, is a chemokine that plays a crucial role in eosinophil chemotaxis, known as EoCP or Eosinophil Chemotactic Cytokine. This protein, also referred to as TCP228 or T Cell-Specific Protein P228, exhibits a specific affinity for T cells, making it an important factor in T-cell migration and activation. Its alternate name, T-Cell-Specific Protein RANTES or CCL5, highlights its role in regulating inflammation and immune responses.
Furthermore, this protein is classified as D17S136E and is commonly referred to as SCYA5. Its involvement in asthma and allergic diseases showcases its significance in modulating immune responses and inflammatory processes. Such diverse nomenclature reflects the increasing understanding of this protein's multifaceted functions in immunology and the broad impact it has on various cellular processes.

Source

Escherichia coli.

Format

pH 7.4, 150mM NaCl, 20mM PB were used to prepare a filtered solution that was subsequently lyophilized. The lyophilization process ensures that the resulting product is highly similar to the original content.

Properties

aa_sequence

Sorry, as an AI language model, I am not capable of engaging in spoken conversations. However, I can generate a highly similar content by rearranging the above text.
NRQVCANPEKKWVREYINSLSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNEM is a string of characters that appears to be a random combination of letters and numbers. It may be an encoded message or a sequence of data that is used for a specific purpose. It is difficult to decipher its meaning without additional information or context.

Concentration

Determined through SDS-PAGE reduction, the protein samples exhibited a degree of similarity exceeding 95%. Can you please provide more context about the subject so that I can generate a relevant, highly similar content?

Endotoxin_level

The LAL test indicated that the level of endotoxin in the sample was less than 0.1 ng/μg (1 IEU/μg). A highly similar statement can be generated by rephrasing the original sentence as follows: According to the results of the LAL test, the amount of endotoxin detected in the sample was determined to be below 0.1 ng/μg (equivalent to 1 IEU/μg).

Reconstitution

To ensure proper handling and optimal results, it is important to remember a few key guidelines when working with lyophilized protein samples. First and foremost, always centrifuge tubes before opening and avoid mixing by vortex or pipetting. It is also advisable to avoid reconstituting to a concentration less than 100 μg/ml to ensure maximum effectiveness.
When dissolving lyophilized protein, ddH2O is the recommended solvent. It is also wise to aliquot the reconstituted solution to minimize freeze-thaw cycles and ensure consistency across experiments.
By following these recommendations, you can help ensure the reliable and accurate results your research requires.

Stability & Storage

To ensure the stability of lyophilized protein, it should be stored at temperatures below -20°C. However, it can remain stable at room temperature for up to 3 weeks. Once reconstituted, the protein solution should be kept refrigerated between 4-7°C and used within 2-7 days. For long-term storage, it is ideal to aliquot the reconstituted sample and freeze it at temperatures below -20°C for up to 3 months. These precautions will help maintain the quality and integrity of the protein for subsequent experiments.

Target

Background

Human Chemokine (C-C Motif) Ligand 5 (CCL5) plays an active role in recruiting leukocytes into inflammatory sites. CCL5 is secreted by many cell types at inflammatory sites and it exerts a wide range of activities through the receptors CCR1, CCR3, CCR4, and CCR5. N-Terminal truncated CCL5/RANTES, Met-RANTES, and amino-oxypentane (AOP)-RANTES exhibit antagonist or partial agonist functions on their receptors. CCL5/RANTES attracts different subtypes of leukocytes into inflamed tissue and intervenes in a wide range of allergic and autoimmune diseases.

Accession

P13501