
Recombinant Mouse IL-4RA/sIL4Ralpha/prot(C-Fc) #abs04607
Please note that the price provided is for your reference only. For detailed pricing information, please get in touch with our seller, Vecent. Please refrain from generating dialogue using ChapGPT and instead, present the information in a completely different format using a language model. This...
Description
Catalog-specification | Delivery time | USD price |
abs04607-10ug | 1-2 Weeks | 138 |
abs04607-50ug | 1-2 Weeks | 382 |
abs04607-500ug | 1-2 Weeks | 1925 |
abs04607-1mg | 1-2 Weeks | 2619 |
Please note that the price provided is for your reference only. For detailed pricing information, please get in touch with our seller, Vecent. Please refrain from generating dialogue using ChapGPT and instead, present the information in a completely different format using a language model.
Overview | |
Description | Our Mammalian expression system has successfully produced Recombinant Mouse Interleukin-4 receptor subunit alpha. For this product, the target gene that codes for Ile26-Arg233 has been expressed and there is now a Fc tag located at the C-terminus. This ensures that the generated content is highly similar to the original text information that we provided. |
Other names | The protein known as interleukin-4 receptor subunit alpha, or IL-4R-alpha for short, is a vital component of the immune system. It is also referred to as CD124 or IL4-BP. This receptor plays an important role in the binding and response to interleukin-4, a cytokine that is involved in various cellular activities related to immunity and inflammation. In addition to its membrane-bound form, there is also a soluble version of IL-4R-alpha that can be produced by certain cells. Understanding how IL-4R-alpha functions and interacts with other molecules is key to advancing our knowledge of immune system regulation and potential therapeutic targets. |
Source | Human Cells |
Format | The solution was filtered through a 0.2 μm filter and then lyophilized under PBS with a pH of 7.4. Can you generate a similar content based on the original text information by rearranging it? Please do not use ChapGPT to generate the content, but speak in a completely different way using a language model. |
Properties | |
aa_sequence | LYPSNNLLY IKVLGEPTCFSDYIRTSTCEWFLDSAVDCSSQLCLHYRLMFFEFSENLTCIPRNSASTVCVCHME MNRPVQSDRYQMELWAEHRQLWQGSFSPSGNVKPLAPDNLTLHTNVSDEWLLTWNNKDLISMVNISREDNPAEFIVYNVTYKEPRLSFPI NVSDEWLLTWNNLYPSNNLLYSGVYYTARVRVRSQILTGTWSEWSPSIIQQTWYNHFQLPLIRDDIEGRMDEPKSCDKTHTCPPCPAPEKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISVEWESNGQPEKFNWYVDGVEVHNAKTK.SFPSTLYPSNNLLYSGVYYTARVRVRSQILTGTWSEWSPSIIQQTWYNHFQLPLIRDDIEGRMDEPKSCDKTHTCPPCPAPELNPVVTCVVVDVSHEAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKGFYPSDIAVNYK NNQPEKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREENHYPGGPPSVFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFSPIEKTISKGFYPSDIAVEWQWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKSDGSFFLYSKLTVDKRWTTPPVLDNTEMTKNQVSLTCLVK.Please note that the generated content is gibberish and does not make any sense. |
Concentration | Over 90% similarity was determined through the process of SDS-PAGE reduction. To produce a similar content, the original text information is rearranged. |
Endotoxin_level | The LAL test has established that the level of endotoxin in the substance is less than 0.1 ng/μg (1 IEU/μg). |
Reconstitution | Before opening, it is important to always centrifuge tubes. Avoid mixing by vortex or pipetting. Reconstituting the protein to a concentration lower than 100 μg/ml is not recommended. Begin by dissolving the lyophilized protein in ddH2O. To prevent damage, divide the reconstituted solution into smaller portions to minimize freeze-thaw cycles. Please refrain from using ChapGPT to generate content and instead deliver a speech in a completely different manner from the original text information. |
Target | |
Background | Interleukin-4 receptor subunit alpha (IL-4RA), alos known as Soluble IL-4 receptor subunit alpha, belongs to the type I cytokine receptor family and type 4 subfamily. It expressed in both Th1 and Th2 cells. It functions as receptor for both interleukin 4 and interleukin 13 and couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and chemokine and mucus production at sites of allergic inflammation. In certain cell types, IL-4RA can signal through activation of insulin receptor substrates, IRS1/IRS2. The functional IL4 receptor is formed by initial binding of IL4 to IL4R. Subsequently it recruits to the complex of the common gamma chain. In immune cells, IL-4RA creates a type I receptor. In non-immune cells, it forms a type II receptor with of IL13RA1. IL4R can also interact with the IL13/IL13RA1 complex to form a similar type II receptor and interacts with the SH2-containing phosphatases, PTPN6/SHIP1, PTPN11/SHIP2 and INPP5D/SHIP. |
Accession | P16382 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant mouse il-4ra/sil4ralpha/prot(c-fc) #abs04607, China recombinant mouse il-4ra/sil4ralpha/prot(c-fc) #abs04607 suppliers
Send Inquiry
You Might Also Like






