Recombinant Mouse IgG2B Fc #abs04690

abs04690-10ug

1-2 Weeks

46

abs04690-50ug

1-2 Weeks

138

abs04690-500ug

1-2 Weeks

695

abs04690-1mg

1-2 Weeks

946

Description

Our expression system is capable of producing the recombinant Mouse Ig gamma-2B chain C region, allowing us to successfully express the target gene that encodes Glu97-Lys335.

Other names

Ig gamma-2 chain C region, IgG2B Fc

Source

Human Cells

Format

The solution containing 20mM PB, 150mM NaCl, and pH 7.4 was filtered through a 0.2 μm filter before being lyophilized.

Properties

aa_sequence

ITPVTVSSQSQASVSTTCSKTVSAHPAKKVTDKKLEPSGPISTINPCPPCKECHKCPAPNLEGGPS VFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVRISWFVNNVEVHTAQTQTHREDYNSTIRVVS ALPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLV VGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLDIKTSKWEKTDSFSCNVRHEGLKN YYLKKTISRSPGKSSVPMTYAVPIIYPMVSDPLPETYKTVWEAIVQAHHALSFNPPTQDSGFAILVC This text contains a unique string of characters, which may represent a specific code or message. Perhaps it is a secret message that only a select few know the meaning of. Regardless of its purpose, the string is difficult to decipher without the proper context or tools. However, with the right knowledge and resources, it is possible to decode the message and uncover its true meaning. Perhaps it holds the key to unlocking a mystery or solving a problem that has eluded us for years.

Concentration

SDS-PAGE，95%。，。

Endotoxin_level

The LAL test has determined that the concentration of endotoxin levels in the substance is less than 0.1 ng/μg (1 International Endotoxin Unit per microgram).

Reconstitution

Remember to always centrifuge your tubes before opening them and avoid mixing the contents through vortexing or pipetting. When reconstituting, it's best to aim for a concentration of at least 100 μg/ml. To dissolve the lyophilized protein, use ddH2O. It's important to aliquot the reconstituted solution to reduce freeze-thaw cycles. Please take care in generating new content that closely reflects the original text.

Target

Background

As a monomeric immunoglobulin that is predominately involved in the secondary antibody response and the only isotype that can pass through the human placenta, Immunoglobulin G (IgG) is synthesized and secreted by plasma B cells, and constitutes 75% of serum immunoglobulins in humans. IgG antibodies protect the body against the pathogens by agglutination and immobilization, complement activation, toxin neutralization, as well as the antibody-dependent cell-mediated cytotoxicity (ADCC). IgG tetramer contains two heavy chains (50 kDa ) and two light chains (25 kDa) linked by disulfide bonds, that is the two identical halves form the Y-like shape. IgG is digested by pepsin proteolysis into Fab fragment (antigen-binding fragment) and Fc fragment ("crystallizable" fragment). IgG1 is most abundant in serum among the four IgG subclasses (IgG1, 2, 3 and 4) and binds to Fc receptors (FcγR ) on phagocytic cells with high affinity. Fc fragment is demonstrated to mediate phagocytosis, trigger inflammation, and target Ig to particular tissues. Protein G or Protein A on the surface of certain Staphylococcal and Streptococcal strains specifically binds with the Fc region of IgGs, and has numerous applications in biotechnology as a reagent for affinity purification. Recombinant IgG Fc Region is suggested to represent a potential anti-inflammatory drug for treatment of human autoimmune diseases.

Accession

P01867