
Recombinant Mouse Fc Receptor-like Protein 1/FCRL1/FcRH1 (C-6His)
This particular item is intended solely for research purposes. It should not be utilized for diagnostic procedures. We advise creating a comparable message by rearranging the aforementioned text, ensuring that the content produced is based on the original information. However, it is recommended...
Description
| SKU-Pack Size | Availability | Price |
| abs04553-10ug | 1-2 weeks | $130.00 |
| abs04553-50ug | 1-2 weeks | $350.00 |
| abs04553-500ug | 1-2 weeks | $2160.00 |
| abs04553-1mg | 1-2 weeks | $2930.00 |
| Overview | |
| Description | Our expression system has successfully produced Recombinant Mouse Fc receptor-like protein 1. The gene sequence, starting from Ala17 to Ser219, has been expressed with a 6His tag located at the C-terminus. It is noteworthy that the newly generated content is primarily based on the original text information but rearranged to form a highly similar yet different content. |
| Synonym | CD307a, also known as Fc receptor-like protein 1, FcR-like protein 1, FcRL1, BXMAS1-like protein 1, mBXMH1, Fc receptor homolog 1, FcRH1, moFcRH1, IFGP family protein 1, or mIFGP1, is an important molecule involved in various biological processes. This protein, encoded by the CD307a gene, shares significant similarities with Fc receptors and is classified as a member of the Ig superfamily. CD307a is primarily expressed on the surface of B cells and plays a crucial role in immune regulation. One of the key functions of CD307a is its involvement in modulating B cell receptor signaling. Through its extracellular domain, CD307a interacts with antigens and regulates the activation and differentiation of B cells. This interaction can either enhance or inhibit B cell signaling, depending on the specific context. CD307a has been shown to modulate the production of antibodies and cytokines in B cells, thus influencing the immune response. Furthermore, CD307a has been implicated in autoimmune disorders and lymphoid malignancies, highlighting its significance in human health and disease. Dysregulation of CD307a expression or aberrant signaling through this receptor can contribute to the pathogenesis of certain autoimmune conditions, such as systemic lupus erythematosus and rheumatoid arthritis. Additionally, CD307a has been shown to be overexpressed in B cell lymphomas, suggesting its potential as a therapeutic target for cancer treatment. In summary, CD307a, also known as Fc receptor-like protein 1, is a multifunctional molecule involved in B cell signaling and immune regulation. Its diverse roles in both physiological and pathological processes make it an intriguing target for further research and potential therapeutic applications in immunology and oncology. |
| Form | The lyophilization process involves subjecting a PBS solution with a pH of 7.4 to filtration through a 0.2 μm filter. This technique ensures the removal of any particulate or microbial contaminants present in the solution. The resulting filtrate is then freeze-dried to obtain a dehydrated product. |
| Properties | |
| Amino Acid Sequence | HFTYSQHKPDPWGGMSELKTRVVMDKIGSVDCRNTYWFIARGAFGLQETTPKLTQSEFAIDSEM KDASQYYCANDHGSPIAVSELIHVSRRVPVSLTFGDTDQAVLVGLDEHLVKCPRSIFYPQFYH ESIIGLNSASPGSGAFNSFLTHSEGNFSCASNEQGAQRSEVVALTNGSLVPENGIHHSLHHHHHH |
| Purity | SDS-PAGE,95%。,。 |
| Endotoxin Level | The LAL test determined that the amount of endotoxin present is below 0.1 ng/μg (1 IEU/μg). A highly similar content can be generated by rephrasing the original text as follows: The detection method of LAL indicates that the level of endotoxin in the sample is less than 0.1 ng/μg (equivalent to 1 International Endotoxin Unit per microgram). |
| Reconstitution | To ensure accurate results, it is essential to follow proper procedures when handling centrifuge tubes. Before opening the tubes, always remember to centrifuge them first. Avoid the use of vortex or pipetting methods for mixing, as they may alter the sample integrity. Moreover, it is important to consider the concentration of the reconstituted solution. We advise against reconstituting the lyophilized protein to a concentration lower than 100 μg/ml. To dissolve the protein, please use ddH2O. This will allow for optimal solubility. Lastly, to maintain the quality of the reconstituted solution, we strongly recommend aliquoting it. By dividing the solution into smaller portions, you can minimize the number of freeze-thaw cycles. This will help preserve the protein's stability and ensure reliable experimental outcomes. |
| Target | |
| Background | FCRL1 is a protein found in B-cells throughout their various stages of development. With a single-pass type I membrane, it consists of an ECD made up of two Ig-like domains, a 21 aa transmembrane segment, and a cytoplasmic domain containing two ITAMs within 103 aa. Despite its resemblance to an immunoglobulin receptor, FCRL1 is unlikely to function as one. Instead, it may act as an activating coreceptor that assists in B-cell activation and differentiation. |
| Accession | Q8R4Y0 |
This particular item is intended solely for research purposes. It should not be utilized for diagnostic procedures. We advise creating a comparable message by rearranging the aforementioned text, ensuring that the content produced is based on the original information. However, it is recommended that language model-generated text that is substantially different from the original be used for speaking purposes rather than relying on ChapGPT-generated text.
Hot Tags: recombinant mouse fc receptor-like protein 1/fcrl1/fcrh1 (c-6his), China recombinant mouse fc receptor-like protein 1/fcrl1/fcrh1 (c-6his) suppliers
Send Inquiry
You Might Also Like






