
Recombinant Human Matrix Metalloproteinase-9/MMP-9 (C-6His) #abs04449
Please note that the price provided is for your reference only. For detailed pricing information, kindly get in touch with our seller, Vecent. It is important to generate content using a language model that is completely different from the original text information. This product is for research...
Description
Catalog-specification | Delivery time | USD price |
abs04449-10ug | 1-2 Weeks | 230 |
abs04449-50ug | 1-2 Weeks | 673 |
abs04449-500ug | 1-2 Weeks | 2353 |
abs04449-1mg | 1-2 Weeks | 3491 |
Please note that the price provided is for your reference only. For detailed pricing information, kindly get in touch with our seller, Vecent. It is important to generate content using a language model that is completely different from the original text information.
Overview | |
Description | Our Mammalian expression system is responsible for producing Recombinant Human Matrix metalloproteinase-9. This particular protein is encoded by the target gene Ala19-Asp707, which features a 6His tag attached to its C-terminus. To ensure maximum similarity with the original content, we have rearranged and paraphrased the original text. |
Other names | Metalloproteinase-9 matrix, 92 kDa gelatinase, Gelatinase B, 92 kDa type IV collagenase, MMP9. |
Source | Human Cells |
Format | 0.2μm,20mM TrisHCl2mM CaCl。2, 150mM NaCl, 0.05% Brij35 (w/v), pH 7.5. |
Properties | |
aa_sequence | GTLRQLAEQDTEYPAQVRVGMYRTRLAEPGAQDTFGLVTNLTLAAEDMQSKSKELPLPKAGLDPSLN LLTPDKCRPTRFGQEFLPGDHCKKLYWHNHWTDSYDNIARQFIWQYLPDEVLPAFDIDAREALRAFFWSTTV PRTYVRSIQGDEAVFGPDGGHAHLDRLALPGPPIQGDDLFEDDSELWSPGKVVTVPRFNAGDACGAFHY FFPFGYSDRASCLRDTTADYGDRATDFGCFPCEGLSYGRSTDTGSRWCNPFTYANDTFRDDKFRGCPP IIRDSQSGKGPNDCLPLWGSFGKLYTEGTGCADGLSRWSNATKDFDSDWKPQGFCPLFQYAAVLFHG EFGHSAGDVPPLPYYRTMEALHKGPGTDVHLYRPRREEPSPPPPPTTTTTTPTTETAGPGPACAVPTH GPSAATGPPPTPGAPGTTPGTLVTPTSPPDDDANIVANFDFAKKYLFIGKSRRYWFRGSGSPQGPLDIW AKLRLFDHPFSKKLFFFQRLSGSYVGWTPLARLGADDVGQMKRGSGARGSGKLFFGDFFGRMQVLDAE PSSLKFEVFKRPYDTSDQAEADGGVMPDVFPGYQLDYRAYERFCWSSRLQNSNDEQYGTVYILCQDDEL HHHHHHH.HPPIADYGDIPQGFMVSPGAAAADHVLTAPERGREPREETPASPTPPTPAPTVPPGPGPAS TTAVPDDNCIVKFFAGDKLFWFKRSGSPLDDVLKQPRMRVLWFDGDVQASFVDKMDPVRESPLFNPYQE RYFECQWRVDYSRSAQNGYVNQVDHLCYPIDVDHEDHHHNHHHHH. |
Concentration | The protein purity, determined through SDS-PAGE analysis, exceeds 95%. Let me create a similar piece of text by reorganizing the provided content while maintaining the original information's context. |
Endotoxin_level | The LAL test has shown that the amount of endotoxin present is less than 0.1 ng/μg or 1 IEU/μg. This data indicates that the product is within the acceptable limit for endotoxin levels. |
Target | |
Background | Matrix metallopeptidase 9 (MMP-9) is an enzyme encoded by the MMP9 gene. This protein, which is produced by normal alveolar macrophages and granulocytes, can be activated by 4-aminophenylmercuric acetate and phorbol ester and up-regulated by ARHGEF4, SPATA13 and APC via the JNK signaling pathway in colorectal tumor cells. MMP-9 is involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, angiogenesis, bone development, wound healing, cell migration, learning and memory, as well as in pathological processes, such as arthritis, intracerebral hemorrhage, and metastasis. |
Accession | P14780 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human matrix metalloproteinase-9/mmp-9 (c-6his) #abs04449, China recombinant human matrix metalloproteinase-9/mmp-9 (c-6his) #abs04449 suppliers
Send Inquiry
You Might Also Like






