Recombinant Human Insulin-like Growth Factor-binding Protein 1/IGFBP1 (C-6His) #abs04670

abs04670-10ug

1-2 Weeks

161

abs04670-50ug

1-2 Weeks

482

abs04670-500ug

1-2 Weeks

2353

abs04670-1mg

1-2 Weeks

3201

Description

Our Mammalian expression system efficiently produces Recombinant Human Insulin-like Growth Factor-binding Protein 1. The gene responsible for encoding Ala26-Asn259 is effectively expressed with a 6His tag located at the C-terminus. We ensure that the content generated is highly similar to the original information presented.

Other names

IGF-binding protein 1, also known as insulin-like growth factor-binding protein 1 or IBP-1, is a protein that binds specifically to insulin-like growth factor 1 (IGF-1) and insulin-like growth factor 2 (IGF-2). It is also referred to as placental protein 12 or PP12 due to its presence in the placenta.
IGF-binding protein 1 plays a crucial role in regulating the activity of IGF-1 and IGF-2, which are essential for growth and development. IBP-1 helps to transport these growth factors throughout the body and also controls their access to target cells, thereby influencing various physiological processes.
Research has shown that alterations in the expression of IBP-1 can have significant effects on metabolic regulation, pregnancy outcome, and even cancer progression. Hence, IBP-1 is being extensively studied for its therapeutic potential in treating various diseases.
Overall, the function and importance of IGF-binding protein 1 make it a significant target for therapeutic intervention and an area of active research in biomedical sciences.

Source

Human Cells

Format

The solution was filtered through a 0.2 μm filter and then lyophilized. It was originally prepared in PBS with a pH of 7.4.

Properties

aa_sequence

LLNSEDEITEETSTEPESEPGAAEHAAHPSADESQEVQCAVGCAALPGAPLMCCGASVRTSEVCSAPS VPCIALLCPMLARGQALCRATAGVACGGAACTRVSENRQLPHQQEGTRGGLTRHPGLAPQEQ QWDAQMYLTSHDIGLSEHDAEPSAMALHVGASSKYDKRKTIWEKRCIPYELERVLESQEAQGKIS FNCNYKSNPGLHRSYFDCSETRDCMPGSPIRGWVYNQPCINHHHHHHDLFAWSIDSEHHMALPD.

Concentration

The level of purity for the sample was found to be over 95%, as confirmed through the implementation of SDS-PAGE analysis. To restate the provided information in a similar but different way, the purity of the sample was determined to be greater than 95% using the method of SDS-PAGE reduction.

Endotoxin_level

The LAL test determined that the concentration is lower than 0.1 ng/μg (1 IEU/μg). Let me generate a content that is highly similar by rephrasing the given information.

Reconstitution

To ensure accurate results, always remember to centrifuge tubes before opening them. Avoid mixing the protein by vortex or pipetting, as this could impact its integrity. Moreover, it is advisable not to dilute the protein below a concentration of 100 μg/ml.
When reconstituting the lyophilized protein, please use ddH2O and avoid any other solvent. To avoid the risk of degradation, we recommend that you aliquot your reconstituted solution, so that you minimize the number of freeze-thaw cycles.
By following these steps, you will ensure that your protein remains stable and consistent throughout your experiments.

Target

Background

Insulin-like growth factor-binding protein 1 (IGFBP1) is encoded by 259 amino acid (aa) with 25 aa residue signal peptide that is processed to generate the 234 aa residue mature protein. IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration. Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs).

Accession

P08833