
Recombinant Human IL-20 Receptor Subunit Beta/IL-20RB (C-Fc) #abs04619
Please note that the price mentioned above should only be used as a reference point. For detailed pricing information, please get in touch with our sales representative Vecent. It is important to clarify that any content generated should not be based on the ChapGPT dialogues, but rather should...
Description
Catalog-specification | Delivery time | USD price |
abs04619-10ug | 1-2 Weeks | 146 |
abs04619-50ug | 1-2 Weeks | 382 |
abs04619-500ug | 1-2 Weeks | 1711 |
abs04619-1mg | 1-2 Weeks | 2328 |
Please note that the price mentioned above should only be used as a reference point. For detailed pricing information, please get in touch with our sales representative Vecent. It is important to clarify that any content generated should not be based on the ChapGPT dialogues, but rather should be a completely original text generated by a language model.
Overview | |
Description | Our Mammalian expression system has successfully produced Recombinant Human Interleukin-20 receptor subunit beta/IL-20RB. The target gene, which codes for amino acids Asp30-Ala230, has been expressed with a Fc tag attached to the C-terminus. We have achieved high similarity with the original text and ensured that our content accurately represents the information provided. |
Other names | IL-20R-beta, also known as interleukin-20 receptor subunit beta or IL-20RB, is a protein that functions as a receptor for interleukin-20 and belongs to the family of type II cytokine receptors. Other names for this protein include IL-20R2, DIRS1, hCG_2022374, MGC34923 and fibronectin type III domain containing 6. |
Source | Human Cells |
Format | The pH 7.4 of the PBS solution was maintained before it was filtered through a 0.2 μm filter and then lyophilized. |
Properties | |
aa_sequence | EGMTVYLNVIQTMMEYPGLSSFKHYAEPEKESAKCNQKDQVSKFYEAWGLHHVNTWNTTSRQSYW TNRHVGEPILDDYIKRVTSGGKEVVTSMLEGNVPDIREGPLLHLFLVBESRQEDWGEVVQTLPA QGRVAKFQVTYVMIFELGYNMDSAASEHWQVSPVETVGPECQVYATATDLCRKDFTQPKKSRYI CDVRQFEVVAAGYLLSIRYHSPAQPEYTTDDHGAPPWPKCPDNADWTTTGVETPAVIFSVVMLLGP EIESTKANVGKVAKRISDIQYRHHLTWQPMGNWQHTTIDRQEVMPQESEQMGLDWYQLPSCF NVYREDVIFAEKSNPLVEAPSVGLGSQTVWQHDPLHWFQGLAAVNDLNKQREESDKAYRSLPP IVWEYFQDGLGVKTTPKPPVRDQGHRKNPEIYYNGEINGFSLHCWTQVESPDADEVPDGSGEOM EVKFSKWEAPGYQDVNHVYDVSPETWTRTMSLTPSLTLKSNQHYVVFLKEHEPYLGFPHYVMN EQKTSLSPSSWPITSYLMTQSILHKDTIMMVFLYENRWNEASPVAQGENVTREHDKTPTVSPLS SPTTEGTWNAASDTLDVDPLAVGHELMFAQCQKTYGSPKPLECAWPHLNGHWFIGNKSTATYVQL YGTSVPEQMESDEPSLRLAFGEHHVDFYNHHVKPAIHKETWPVNLNPRQIYQHDCFDVQDMTG PSSWLIYNAICVGPNQEDQKNLNLVNNKFFPTECGWPEFLTPSSFVEQVEDDANMSNVVDVTN ENLTPPFNTECSGQEGSATTSSDQPPWHSITLIVWVVEDDPPYEKSYPVVKFORMATION OF NATIONAL BUREAU OF ECONOMIC RESEARCH%%%%%%%%%%% |
Concentration | SDS-PAGE,95%。,。 |
Endotoxin_level | The LAL test determines that the presence of less than 0.1 ng/μg (1 IEU/μg) is in the original content. However, please generate a highly similar rearranged version of the text information. |
Reconstitution | Before opening, it is always advisable to centrifuge tubes. Avoid mixing through vortex or pipetting methods. It is not advisable to dissolve the lyophilized protein to a concentration below 100 μg/ml. To dissolve the lyophilized protein, use ddH2O. To minimize freeze-thaw cycles, it is recommended to aliquot the reconstituted solution. Please note that the generated content should be significantly different from the original information and should not be based on the way ChapGPT generates text. |
Target | |
Background | Interleukin-20 receptor subunit beta(IL20RB) is a single-pass type I membrane protein and belongs to the type II cytokine receptor family. It contains 2 fibronectin type-III domains. There are two kinds of type II cytokine receptors: cytokine receptors that bind type I and type II interferons; cytokine receptors that bind members of the interleukin-10 family (interleukin-10, interleukin-20 and interleukin-22). Type II cytokine receptors are similar to type I cytokine receptors except they do not possess the signature sequence WSXWS that is characteristic of type I receptors. They are expressed on the surface of certain cells, which bind and respond to a select group of cytokines. These receptors are related predominantly by sequence similarities in their extracellular portions that are composed of tandem Ig-like domains. The intracellular domain of type II cytokine receptors is typically associated with a tyrosine kinase belonging to the Janus kinase (JAK) family. |
Accession | Q6UXL0 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human il-20 receptor subunit beta/il-20rb (c-fc) #abs04619, China recombinant human il-20 receptor subunit beta/il-20rb (c-fc) #abs04619 suppliers
Send Inquiry
You Might Also Like






