Recombinant Human Fc Receptor-Like Protein 1/FCRL1/CD307a (C-6His)
Please keep in mind that this product is meant solely for research purposes and should not be utilized in diagnostic procedures.
Description
| SKU-Pack Size | Availability | Price |
| abs04351-10ug | 1-2 weeks | $110.00 |
| abs04351-50ug | 1-2 weeks | $310.00 |
| abs04351-500ug | 1-2 weeks | $2160.00 |
| abs04351-1mg | 1-2 weeks | $2930.00 |
| Overview | |
| Description | Our Mammalian expression system is utilized to produce Recombinant Human FcRL1. The target gene, which encodes Ala17-Asn303, is expressed with a 6His tag at the C-terminus. Take note that the following content is based on the original information provided but has been rearranged to ensure similarity. |
| Synonym | CD307a, FCRH1, Fc Receptor-Like Protein 1, FcRL1, FcRH1, Fc Receptor Homolog 1, FCR1, FcRH1, Immune Receptor Translocation-Associated Protein 5, IFGP Family Protein 1, hIFGP1, IRTA5. These names refer to a protein known as Fc Receptor-Like Protein 1. This protein, also called FcRL1, is a member of the Fc receptor family and shares significant homology with Fc receptors. FcRL1 belongs to the IFGP family and is encoded by the IFGP1 gene. It is associated with immune receptor translocation and is commonly referred to as IRTA5. The various names reflect different naming conventions used by researchers and scientists to refer to this protein. However, regardless of the name used, all refer to the same Fc receptor-like protein 1. |
| Form | The solution used for lyophilization was prepared by filtering it through a 0.2 μm filter. The solution contained 20mM PB, 150mM NaCl, and 1mM EDTA, and had a pH value of 7.4. The resulting content will be highly similar to the original text, but the phrasing and structure may be different. |
| Properties | |
| Amino Acid Sequence | VTEMKWAIDTQSPLETGSPVSLCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPYLQIAAMWSGEDS GSYWCEAQSMASKVLRSRRSQINHVLPVADVSLQTQEPGQVMEGDRLVLICSVAMGTGDITFLW YKGAVGLNLQSKTQRSLTAEYEIPRSVSAEDAEQYYCVAENGYGPSPSGLTSITVIPVSRPILML RAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSC EANNGLGAQRSEAVTLNFTVPTGARSNVDHHHHHH. |
| Purity | The percentage was found to be over 95% through the use of SDS-PAGE reduction. It is possible to create content that closely mirrors this information by rephrasing the original text, taking care to retain its meaning and substance. |
| Endotoxin Level | The LAL test determined that the amount of endotoxin present is less than 0.1 ng/μg (1 IEU/μg). Can you please provide me with more details on how this was determined? |
| Reconstitution | To ensure optimal results, it is essential to centrifuge any tubes containing lyophilized protein before opening them. Avoid mixing the contents by pipetting or vortexing to minimize any potential damage to the protein's structure. Additionally, it is recommended that you reconstitute the protein to a concentration no less than 100 μg/ml. To do so, dissolve the lyophilized protein in ddH2O carefully. Once reconstituted, it's crucial to aliquot the solution to reduce any freeze-thaw cycles. This will help preserve the protein's integrity and ensure consistent and accurate results. |
| Target | |
| Background | The activating coreceptor known as Fc Receptor-Like Protein 1 (FCRL1) is a protein found in B cells that is embedded in the cell membrane. It is involved in the activation of B cells. FCRL1 is predominantly found in secondary lymphoid tissues and is expressed by mature subsets of B cells. It can be detected in various organs such as the spleen, lymph nodes, heart, skeletal muscle, kidney, liver, and placenta. The protein is specifically found in mature B lineage cells, with higher levels observed in naive B cells compared to memory B cells. FCRL1 consists of three extracellular C2-like immunoglobulin domains, a transmembrane domain, and a cytoplasmic domain that contains two immunoreceptor-tyrosine activation motifs. It is believed to play a role in regulating the growth of cancer cells. |
| Accession | Q96LA6 |
Please keep in mind that this product is meant solely for research purposes and should not be utilized in diagnostic procedures.
Hot Tags: recombinant human fc receptor-like protein 1/fcrl1/cd307a (c-6his), China recombinant human fc receptor-like protein 1/fcrl1/cd307a (c-6his) suppliers
Send Inquiry
You Might Also Like
