Recombinant (2019-nCoV) Nucleocapsid Protein(N-6his) #abs04701

abs04701-100ug

In Stock

819

abs04701-15ug

In Stock

182

Other names

Proteins associated with the 2019-nCoV coronavirus include the Coronavirus NP protein, Coronavirus Nucleocapsid protein, and Coronavirus Nucleoprotein protein. These proteins, namely cov NP protein, ncov NP protein, and NCP-CoV Nucleocapsid protein, play pivotal roles in the novel coronavirus. Their significance lies in their unique characteristics and their contribution to the understanding of 2019-nCoV.
The novel coronavirus NP protein, cov np protein, and nucleocapsid protein are of particular interest due to their involvement in the replication and assembly of the virus. These proteins possess specific structural elements essential for their functional roles in the viral life cycle. Through interactions with various cellular factors, they facilitate the packaging of viral RNA, thereby enabling viral particle formation.
The nucleocapsid protein, np protein, and nucleoprotein protein are crucial for the stability of the viral genome. They maintain the integrity of the viral RNA and protect it from degradation. Additionally, they are involved in the modulation of host immune responses, potentially contributing to the pathogenicity of the virus.
Understanding the functions and properties of these proteins is of utmost importance for the development of effective diagnostic tools, therapeutic interventions, and preventive measures against 2019-nCoV. Further research and characterization of the Coronavirus NP protein, Nucleocapsid protein, and Nucleoprotein protein will aid in unraveling the intricate mechanisms underlying the replication and pathogenesis of the novel coronavirus.

Source

E.coli

Appearance

Power

Format

The concentrated solution was filtered through a 0.2 μm filter and then lyophilized. To preserve the stability of the solution, 0.05% proclin300 was added to the PBS buffer. Can you produce a similar piece of content by rephrasing the original text while staying true to its meaning?

Properties

aa_sequence

MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQG

VPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDH

IGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAAL

ALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELI

RQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTE

PKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA

Activity

Tested

Reconstitution

Before opening, make sure to centrifuge all tubes. Do not mix by pipetting or vortexing. To maintain quality, it is recommended to not reconstitute the protein to a concentration less than 100 μg/ml. In order to dissolve the lyophilized protein, use ddH2O. To prevent damage, divide the reconstituted solution into smaller aliquots to minimize freeze-thaw cycles. Please take note of this recommendation.

Stability & Storage

It is recommended to store lyophilized protein below -20°C, although it can remain stable at room temperature for a period of three weeks. Once reconstituted, the protein solution should be stored at a temperature range of 4-7°C and can be maintained for a duration of 2-7 days. For long-term storage, aliquots of the reconstituted samples should be stored at temperatures below -20°C where they will remain stable for up to three months.