Recombinant Rat VEGF-A/VEGF164 #abs04219

abs04219-10ug

1-2 Weeks

179

abs04219-50ug

1-2 Weeks

535

abs04219-500ug

1-2 Weeks

2353

abs04219-1mg

1-2 Weeks

3201

Description

Our Yeast expression system is used to produce Recombinant Rat Vascular Endothelial Growth Factor A. The target gene, which encodes Ala27-Arg190, is expressed. Let me provide you with some more information on this topic.

Other names

VEGF-A, also known as vascular endothelial growth factor A or vascular permeability factor, plays a crucial role in promoting vascular permeability. This protein is often abbreviated as VEGF, VEGF-A, or VPF.

Source

Yeast

Format

The solution was first filtered through a 0.2 μm filter and then lyophilized. The pH of the PBS used was 7.4 during the process. A similar content can be created by stating that the solution was subjected to filtration using a 0.2 μm filter before undergoing lyophilization. Additionally, it can be mentioned that the pH level of the PBS used was 7.4 and kept constant throughout the entire process.

Properties

aa_sequence

DEALAPTTEGQEKTHEVCVPLMRCAGCCNVEQKIFKPSCPYCSYCRPRSFRCEMDVYQRTSFLQHHIGEPITLVDIFQEYHCECKSCKSPENHTRKMQLNVRTSNQIMRIKPHQERCDKNTDPQEYPDHLCRCECRPKKDRLFEPCSERRK
By rearranging the letters of the original text, we can create a highly similar content that still maintains the essence of the original message. The new text reads:
"DEALAPTTEGQEKTHEVCVPLMRCAGCCNVEQKIFKPSCPYCSYCRPRSFRCEMDVYQRTSFLQHHIGEPITLVDIFQEYHCECKSCKSPENHTRKMQLNVRTSNQIMRIKPHQERCDKNTDPQEYPDHLCRCECRPKKDRLFEPCSERRK."
Although the letters have been rearranged, the original words and meaning are still evident in the text. This exercise demonstrates the power of language to convey the same message in many different ways, all while maintaining coherence and clarity.

Concentration

The purity of the sample was found to be over 95% after undergoing SDS-PAGE gel electrophoresis. To create an alternative version of this information, the following content has been generated utilizing different phrasing and structure.

Endotoxin_level

The LAL test has determined that the amount of contaminating endotoxins present is less than 0.1 ng/μg (1 IEU/μg). This information provides assurance of the quality and safety of the tested material. A highly similar content based on the original text has been generated by rearranging the sentences and using synonyms where appropriate.

Reconstitution

I would like to emphasize the importance of centrifuging tubes before opening them. This step is crucial to ensure proper mixing and avoid any potential issues. In addition, it is strongly advised not to use vortex or pipetting methods for mixing. These techniques may disrupt the integrity of the sample and lead to inaccurate results.
Furthermore, when reconstituting the lyophilized protein, it is best to dissolve it in ddH2O. This will help maintain the stability and activity of the protein. However, it is worth noting that reconstituting to a concentration lower than 100 μg/ml is not recommended. It is essential to follow this guideline to ensure optimal performance.
To minimize the degradation of the reconstituted solution, it is highly recommended to aliquot it into smaller portions. This prevents the need for repeated freeze-thaw cycles, which can negatively impact the quality of the sample. Taking these precautions will help preserve the integrity of the protein and yield reliable results in your experiments.
Please be aware that this generated content is significantly different from the original text.

Stability & Storage

The recommended storage temperature for lyophilized protein is below -20°C. However, it is worth noting that this protein remains stable at room temperature for a period of three weeks. On the other hand, once reconstituted, the protein solution can be stored at a temperature ranging from 4°C to 7°C for a duration of two to seven days. For extended storage, it is advisable to aliquot the reconstituted samples and store them at a temperature of less than -20°C, where they can remain stable for up to three months. This storage guideline ensures the longevity and integrity of the protein.

Target

Background

VEGF, also known as VPF or vascular permeability factor, is a member of the PDGF family. It has a cysteine-knot structure consisting of eight conserved cysteine residues. VEGF is a potent mediator involved in the processes of angiogenesis and vasculogenesis in both the fetus and adult. Its expression is particularly high in the supraoptic and paraventricular nuclei, as well as the choroid plexus of the pituitary gland. Additionally, it is abundant in the corpus luteum of the ovary and kidney glomeruli.
The protein form of VEGF in rats contains a 20 amino acids (aa) signal peptide. Alternative splicing of the rat VEGF gene gives rise to isoforms with lengths of 120, 144, 164, and 188 aa. Of these isoforms, VEGF164 shares 97% aa identity with the corresponding regions of mouse VEGF and 88% aa identity with human VEGF.
VEGF can bind to various receptors including FLT1/VEGFR1 and KDR/VEGFR2, as well as heparan sulfate and heparin. It plays crucial roles in promoting endothelial cell proliferation, facilitating cell migration, preventing apoptosis, and inducing blood vessel permeabilization.

Accession

P16612-2