Recombinant Mouse C-X-C Motif Chemokine 15/CXCL15/Lungkine (C-6His) #abs04171

abs04171-10ug

1-2 Weeks

230

abs04171-50ug

1-2 Weeks

673

abs04171-500ug

1-2 Weeks

2353

abs04171-1mg

1-2 Weeks

3491

Description

Our Mammalian expression system is utilized to produce Recombinant Mouse C-X-C motif chemokine 15. The target gene, which encodes Gln26-Ala167, is expressed with a 6His tag at the C-terminus. With this system, we are able to generate a product that is highly similar to the original, maintaining the integrity of the target gene's sequence. By using the 6His tag at the C-terminus, we ensure that the protein is easily purified, making it an ideal option for various applications in research and biotechnology.

Other names

There are various names for the C-X-C motif chemokine 15, which is also known as Cxcl15, Lungkine, Small-inducible cytokine B15, and Scyb15. These different names all refer to the same protein, which is a chemotactic cytokine that plays a role in immune system function. Despite having different names, they all serve the same purpose of identifying and referring to this important molecule.

Source

Human Cells

Format

The solution was filtered through a 0.2 μm filter and then lyophilized. It contained 20mM Tris and 150mM NaCl, with a pH of 8.0. To create similar content, the original information can be rearranged to read: The pH8.0 solution included 150mM NaCl and 20mM Tris, which was filtered through a 0.2 μm filter and subsequently lyophilized.

Properties

aa_sequence

DRNFLRDSSEVSLTGSDAVDHHHHHHRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSQELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPI TN

Concentration

The protein purity was found to be more than 95% by performing SDS-PAGE analysis. Can you please provide me with a paraphrased version of this information? I'd like the content to be similar but reworded in a unique way.

Endotoxin_level

The LAL test has shown that the level of endotoxins in the sample is less than 0.1 ng/μg (1 IEU/μg). This indicates a low presence of harmful contaminants in the tested substance.

Reconstitution

To ensure accurate results, it is important to always centrifuge tubes before opening and avoid mixing the contents by vortexing or pipetting. When reconstituting lyophilized protein, it is not recommended to go below a concentration of 100 μg/ml and it should be dissolved in ddH2O. To prevent degradation, it is advised to aliquot the reconstituted solution and avoid excessive freeze-thaw cycles. These steps will guarantee that the protein maintains its integrity and provides reliable data.

Stability & Storage

It is recommended to store lyophilized protein at temperatures below -20°C, although it can remain stable at room temperature for up to 3 weeks. Once the protein has been reconstituted, it should be kept at a temperature between 4-7°C for 2-7 days. If you need to store the reconstituted protein for a longer period of time, it is recommended to freeze aliquots of the sample at temperatures below -20°C, where it should remain stable for up to 3 months.

Target

Background

Mouse C-X-C motif chemokine 15, also known as Cxcl15, is a secreted protein which is member of the ELR motif-containing CXC chemokines. It expressed at low levels in fetal lung, the expression restricted to the lung, produced by bronchoepithelial cells and is released into the airways. It plays an important role in lung-specific neutrophil trafficking during normal and inflammatory conditions. It also appears chemotactic for neutrophils.

Accession

Q9WVL7