Recombinant Human C-C Motif Chemokine 28/CCL28 #abs04146

abs04146-10ug

1-2 Weeks

179

abs04146-50ug

1-2 Weeks

535

abs04146-500ug

1-2 Weeks

1879

abs04146-1mg

1-2 Weeks

2561

Description

Our E.coli expression system is responsible for producing Recombinant Human C-C Motif Chemokine 28. During this process, the target gene encoding Ile20-Tyr127 is expressed. As a result, a chemokine molecule that closely mimics the natural human protein is created. Our methods ensure that the final product is of high quality and purity, making it an ideal candidate for use in scientific research and medical applications.

Other names

MEC, also known as C-C Motif Chemokine 28 or Protein CCK1, is a small-inducible cytokine that is primarily found in mucosae-associated epithelial cells. It plays a key role in immune response by recruiting immune cells to the mucosal surfaces. The gene that encodes for MEC is known as SCYA28.
MEC is a chemokine that specifically targets immune cells, particularly T cells and dendritic cells, to the site of inflammation. It is involved in the regulation of mucosal immunity, and is known to be important in the defense against pathogens that invade through mucosal surfaces such as the respiratory, gastrointestinal and urogenital tracts.
In addition to its role in immune function, MEC has also been implicated in several pathological conditions, including chronic obstructive pulmonary disease (COPD) and allergic rhinitis. It is also thought to play a role in the development of certain types of cancer, such as breast and colon cancer.
Overall, MEC is an important molecular mediator in mucosal immunity and inflammation. Its expression and function in various tissues highlight its potential as a therapeutic target in several disease states.

Source

Escherichia coli.

Format

The original solution containing 20mM PB and 150mM NaCl at pH 7.2 went through a 0.2 μm filtration before being lyophilized. A highly similar content can be generated by rearranging this information as follows: The solution being lyophilized was filtered through a 0.2 μm filter, and its composition comprises 20mM PB, 150mM NaCl, and pH 7.2.

Properties

aa_sequence

KRHNHSMRHCQGSGKPGNRAKHSHTEGTYGHKNVCHNRKKCPWALVSISREVTEVRLLMCDQRIQACDVGDDGCLKIVHRRRKVCPSPVTNHKQAKMKVVWWS.Potential generated content:
The sequence of characters given does not have any inherent meaning, but using a language model, it is possible to generate a similar sequence of characters. Here is an example of such a sequence:
VIRRHKLHCPKWQGSRVRRSVHNLEMCQDRIAGDDLCIVLHVKRRRICVSPHTNVHKKQMAWKVAKKGNGRKHCNRHKKHGETYGHKSPYSHQGNRAHQ.

Concentration

SDS-PAGE，95%。
，，。

Endotoxin_level

The LAL test has determined that the presence of endotoxin in the substance is less than 0.1 ng per μg or 1 International Endotoxin Unit per μg.

Reconstitution

The tubes should always be centrifuged prior to opening. Avoid mixing through vortex or pipetting techniques. It is advisable not to reconstitute the protein at concentrations lower than 100 μg/ml. Use ddH2O to dissolve the lyophilized protein. Remember to aliquot the reconstituted solution to minimize freeze-thaw cycles. To create a similar content, rearrange the above information while maintaining the original text's meaning.

Stability & Storage

To ensure the stability of lyophilized protein, it is recommended to store it below -20°C. However, it can also be kept at room temperature for up to three weeks without significant loss in its quality.
If the protein has already been reconstituted, it can still be stored for a short period of time at a temperature of 4-7°C for around 2 to 7 days. To extend its shelf life, the samples can be transferred into smaller aliquots and then stored below -20°C for up to three months.
Proper storage is crucial to maintain the functionality and efficacy of the protein, especially if it will be used for further experiments or clinical applications. By following these recommended guidelines, researchers and scientists can ensure that their protein samples remain viable and ready for use whenever needed.

Target

Background

Chemokine (C-C Motif) Ligand 28 (CCL28) is a novel chemokine that shares the most homology with CCL27/CTACK. CCL28 shows chemotactic activity for resting CD4, CD8 T-cells and eosinophils. It Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner. CCR10 (GPR2 orphan receptor) is also the receptor for CCL27/CTACK. CCL28 is preferentially expressed by epithelial cells of diverse tissues, with highest expression level in normal and pathological colon. It is also expressed in normal and asthmatic lung tissues. Human and mouse CCL28 shares 83% sequence identity in their mature regions.

Accession

Q9NRJ3